SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000324 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000324
Domain Number 1 Region: 392-518
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000022
Family Growth factor receptor domain 0.0064
Further Details:      
 
Domain Number 2 Region: 329-370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000138
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 3 Region: 296-332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000144
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000000324
Domain Number - Region: 369-399
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0838
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 178-326
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0957
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000324   Gene: ENSNLEG00000000274   Transcript: ENSNLET00000000348
Sequence length 723
Comment pep:known_by_projection supercontig:Nleu1.0:GL397520.1:796638:804780:-1 gene:ENSNLEG00000000274 transcript:ENSNLET00000000348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFF
RVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIRFPFGFTWPGTF
SLIIEALHTDSPDDLATENPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFVCD
EHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWEGPYCTEPICLPGCDEQHGFCDKP
GECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCKN
GATCTNTGQGSYTCSCRPGYTGATCELGIDECDPSPCKNGGSCTDLENSYSCTCPPGFYG
KICELSAMTCADGPCFNGGRCSDSPDGGYSCRCPVGYSGFNCEKKIDYCSSSPCSNGAKC
VDLGDAYLCRCQAGFSGRHCDDNVDDCASSPCANGGTCRDSVNDFSCTCPPGYTGRNCSA
PVSRCEHAPCHNGATCHERGHRYVCECAQGYGGPNCQFLLPELPPGPAVVDLTEKLEGQG
GPFPWVAVCAGVILVLMLLLGCAAVVVCVRLRLQKRRPPADPCRGETETMNNLANCQREK
DISVSVIGATQIKNTNKKADFHGDHSANKNGFKARYPAVDYNLVQDLKGDDAAVRDAHSK
RDTKCQPQGSSGEEKGTATTLRGGEAPERKRRDSGCSTSKDTKYQSVYVISEEKDECVIA
TEV
Download sequence
Identical sequences G1QHD7
XP_003281038.1.23891 ENSNLEP00000000324 ENSNLEP00000000324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]