SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000366 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000366
Domain Number 1 Region: 382-645
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.51e-76
Family Eukaryotic proteases 0.0000969
Further Details:      
 
Domain Number 2 Region: 264-377
Classification Level Classification E-value
Superfamily Kringle-like 9.18e-33
Family Kringle modules 0.0003
Further Details:      
 
Domain Number 3 Region: 100-149
Classification Level Classification E-value
Superfamily Kringle-like 4.32e-17
Family Fibronectin type II module 0.0019
Further Details:      
 
Domain Number 4 Region: 160-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000192
Family EGF-type module 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000000366
Domain Number - Region: 198-237
Classification Level Classification E-value
Superfamily FnI-like domain 0.00319
Family Fibronectin type I module 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000366   Gene: ENSNLEG00000000301   Transcript: ENSNLET00000000391
Sequence length 654
Comment pep:known_by_projection supercontig:Nleu1.0:GL397450.1:1819621:1827206:1 gene:ENSNLEG00000000301 transcript:ENSNLET00000000391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRWAWVPSPCPPPGLGPFLLLLLLLLLPRGFQPQPGGNRTESPEPNATATPAIPTVLVT
SVTSETPATSAPEAEGPQSGRLPPPPRAVPSSSSPQAQALTEDGRPCRFPFRYGGRMLHA
CTSEGSAHRKWCATTLNYDRDRAWGYCVQGTRSGAQPAALDPCASGPCLNGGSCSNTQDP
QSYHCSCPRAFTGKDCGTEKCFDETRYEYLDGGDRWVRVRQGHVEQCECLGGRARCEGTR
HTACLSSPCLNGGTCHLIVATGTTVCACPPGLAGRLCNIKPDERCFLGNGTGYRGVASTS
ASGLSCLAWNSDLLYQELHVDSVGTAALLGLGPHAYCRNPDNDERPWCYVVKDSALSWEY
CRLEACESLTRVQLSPDLLATLPEPASPGRQACGRRHKKRTFLRPRIIGGSSSLPGSHPW
LAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRESVSVVLGQHFFNRTTDVTQTFGIEK
YIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWG
HLDENVSGYSSSLREALVPLVADHKCSSPEVYGTDISPNMLCAGYFDCKSDACQGDSGGP
LACEKNGVAYLYGIISWGDGCGRLHKPGVYTRVANYVDWINDRIRPPRRLVAPS
Download sequence
Identical sequences ENSNLEP00000000366 ENSNLEP00000000366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]