SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000409 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000409
Domain Number 1 Region: 137-218
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, C-terminal domain 5.23e-18
Family Translation initiation factor IF3, C-terminal domain 0.004
Further Details:      
 
Domain Number 2 Region: 57-127
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, N-terminal domain 0.0000000418
Family Translation initiation factor IF3, N-terminal domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000409   Gene: ENSNLEG00000000343   Transcript: ENSNLET00000000434
Sequence length 257
Comment pep:known_by_projection supercontig:Nleu1.0:GL397329.1:422144:427288:-1 gene:ENSNLEG00000000343 transcript:ENSNLET00000000434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XCFGKHIVQKTAPAQSSPIASPPRLSFLIRAKAFSTAEDTQNEGKKKKKNKTVFSNVGRK
ISQRIIHLFDEKGNDLGNMHRANVIRLMDERDLRLVERNTSIEPAEYQLMTGLQILQERQ
RLREMEKASPKTGPTLRKELTLSSNIGQHDLDTKTKQIQQWIKKKHLVRITIKKGKNVDM
SENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRALSKNEEKAYRETQETQERD
TLNKDHGNDKESNVLHQ
Download sequence
Identical sequences ENSNLEP00000000409 ENSNLEP00000000409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]