SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000500 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000500
Domain Number 1 Region: 183-507
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 2.35e-64
Family Glutamine synthetase catalytic domain 0.00056
Further Details:      
 
Domain Number 2 Region: 73-179
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 4.71e-20
Family Glutamine synthetase, N-terminal domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000500   Gene: ENSNLEG00000000430   Transcript: ENSNLET00000000535
Sequence length 509
Comment pep:known_by_projection supercontig:Nleu1.0:GL397384.1:1643111:1684704:-1 gene:ENSNLEG00000000430 transcript:ENSNLET00000000535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNEEDLLQEEGSETEANETEANSMNTLRRTRKKVTKPHVCSTEVGEMDMSNSNDCMKDS
SQILAPPPLSSRMKHIRQAMAKNRLQFVRFEATDLHGVSRSKTIPAHFFQEKVSHGVCMP
RGYLEVIPSPKDNEMNHIRATCFNSDIVLMPEISTFRVLPWAERTARVICDTFTVTGEPL
LTSPRYIAKRQLSQLQASGFSLLSAFIYDFCIFGVAEILNSKTISFPASTFLNNHDQPFM
QELVDGLYHTGANVESFSSSTRPGQMEICFLPEFGISSADNAFTLRTGVKEVARKYNYIA
SFFIETGFCNSGILSHSLWDVDRKKNMFCSTSETEQLTITGKKWLAGLLKHSAALSCLMA
PSVSCRKRYSKDRKDLKESVPTTWGYNDNSCIFNIKCHGEKGTRIENKLGSATANPYLVL
AATVAAGLDGLHSGNEVLAGPDESPDFYQVEPSEIPLKLEDALVALEEDQCLRQALGETF
IRYFVAMKKYELENEKIAAERNKFLEYFI
Download sequence
Identical sequences ENSNLEP00000000500 ENSNLEP00000000500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]