SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000525 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000525
Domain Number 1 Region: 62-103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000286
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000000525
Domain Number - Region: 243-467
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0137
Family Rhodopsin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000525   Gene: ENSNLEG00000000450   Transcript: ENSNLET00000000561
Sequence length 473
Comment pep:novel supercontig:Nleu1.0:GL397610.1:244555:278348:-1 gene:ENSNLEG00000000450 transcript:ENSNLET00000000561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRCLLVLLSGLTVLLALPGSEAKNSGASCPPCPKYANCHNSTHCTCEDGFQARSGRTY
FHDSSEKCEDINECETGLAKCKYNAYCRNKIGGYICSCLVKYPIFNVLASIIDYDHPDCY
ENSRGTTQSNVDIWENLRRDGSREDFARRATQLIQSVELGIWNTSFASPGKGQISEFDVV
YETKRCNETRENAFLEAGNNTMDINCADALKGTLRESTAVALSRINLLGILPIQNTSTSL
HLQLSLCLFLAHLLFLTGINRTEPEVLCSIIAGLLHFLYLACFTWMLLEGLHLFLTVRNL
RVANYTSTGRFKKRFMCPVGYGIPAVIIVVSAIVGPQNYGTFTHCWLKLDKGFIWSFMGP
VAVIILINLVFYFQVLWILRSKLSSLNKEVSTIQDTRVMTFKAIAQLFILGCSWGLGFFM
VEEVGKTIGSIIAYSFTIINTLQGVLLFVVHCLLNRQVRLIILSVISLVPKSN
Download sequence
Identical sequences ENSNLEP00000000525 ENSNLEP00000000525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]