SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000540 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000540
Domain Number 1 Region: 429-731
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.77e-73
Family Protein kinases, catalytic subunit 0.000000442
Further Details:      
 
Domain Number 2 Region: 266-388
Classification Level Classification E-value
Superfamily Kringle-like 5.56e-35
Family Kringle modules 0.00026
Further Details:      
 
Domain Number 3 Region: 68-156
Classification Level Classification E-value
Superfamily Immunoglobulin 1.56e-21
Family I set domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000540   Gene: ENSNLEG00000000461   Transcript: ENSNLET00000000576
Sequence length 929
Comment pep:known_by_projection supercontig:Nleu1.0:GL397461.1:1680276:1907937:-1 gene:ENSNLEG00000000461 transcript:ENSNLET00000000576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWGSALPRRSLLCIPAVWAAAALLLSVSRTSGEVEVPDPNDPLGPLDGQDGPIPTLKGY
FLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRL
RIQDLDTTDTGYYQCVATNGMKTITATGVLFVRLGPTHSPNHNFQDDYHEDGFCQPYRGI
ACARFIGNRTIYVDSLQMQGEIENRITADFTMIGTSTHLSDQCSQFAIPSFCHFVFLCDA
SRAPKPRDLCRQEYTIARSNPLILMRLQLPKCEALPMPESPDAANCMRIGIPAERLGRYH
QCYNGSGMDYRGTASTTKSGHQCQPWALQHPHSHHLSSADFPELGGGHAYCRNPGGQMEG
PWCFTQNKNVRMELCDVPSCSPRDSSKMGILYILVPSITIPLVIACLFFLVCMCRNKQKA
SASTPQRRQLMASPSQDMEMPLINQHKQAKLKEISLSAVRFMEELGEDRFGKVYKGHLFG
PAPGEQTQAVAIKTLKDKAEGSLREEFRHEAMLRARLQHPNIVCLLGVVTKDQPLSMIFS
YCSHGDLHEFLVMRSPHSDVGSTDDDRTVKSALEPPDFVHLVAQIAAGMEYLSSHHVVHK
DLATRNVLVYDKLNVKISDLGLFREVYAADYYKLLGNSLLPIRWMAPEAIMYGKFSIDSD
IWSYGVVLWEVFSYGLQPYCGYSNQDVVEMIRNRQVLPCPDDCPAWVYALMIECWNEFPS
RRPRFKDIHSRLRAWGNLSNYNSSAQTSGASNTTQTSSLSTSPVSNVSNARYVGPKQKAP
PFPQPQFIPVKGQIRPMVPPPQLYIPVNGYQPVPAYGAYLPNFYPVQIPMQMAPQQVPPQ
MVPKPSSHHSGSGSTSTGYVTTAPSNTSVADRAALLSEGAEDAQNTPEDGAQSPVQEAEE
EEEGSVPETELLGDCDTLQVDEAQVQLEA
Download sequence
Identical sequences ENSNLEP00000000540 ENSNLEP00000000540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]