SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000621 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000621
Domain Number 1 Region: 62-333
Classification Level Classification E-value
Superfamily Radical SAM enzymes 1.57e-74
Family MoCo biosynthesis proteins 0.00000542
Further Details:      
 
Domain Number 2 Region: 489-633
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis protein C, MoaC 4.97e-52
Family Molybdenum cofactor biosynthesis protein C, MoaC 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000621   Gene: ENSNLEG00000000514   Transcript: ENSNLET00000000662
Sequence length 636
Comment pep:known_by_projection supercontig:Nleu1.0:GL397547.1:60637:90528:-1 gene:ENSNLEG00000000514 transcript:ENSNLET00000000662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARPLSRMLRRPLRSSARSCSSGAPVTQPRPGESARAASEELSRRRQFLREHAAPFSAF
LTDTFGRQHSYLRISLTEKCNLRCQYCMPEEGVPLTPKANLLTTEEILTLARLFVKEGVD
KIRLTGGEPLIRPDVVDIVAQLQRLEGLRTIGVTTNGINLARLLPQLQKAGLSAINISLD
TLVPAKFEFIVRRKGFHKVMEGIHKAIELGYNPVKVNCVVMRGLNEDELLDFAALTEGLP
LDVRFIEYMPFDGNKWNFKKMVSYKEMLDTVRQQWPELEKLPEEESSTAKAFKIPGFQGQ
ISFITSMSEHFCGTCNRLRITADGNLKVCLFGNSEVSLRDHLRAGASEQELLRIIGAAVG
RKKRQHAGMFSISQMKNRPMILIELFLMFHDSPPGNPSISSWDPLHVQGLRPRMSFSSQM
ATLWKGYRVPQTPPLAQQQLGSGSFQRHYTSHADSDANSKCLSPGSWAPAAPSGPQLTSE
QLTHVNSEGRAAMVDVGRKPDTERVAVASAVVLLGPVAFKLVQQNQLKKGDALVVAQLAG
VQAAKVTSQLIPLCHHVALSHVQVQLELDSTHHAVKIQASCRARGPTGVEMEALTSAAVA
ALTLYDMCKAVSRDIVLEEIKLISKTGGQRGDFHRA
Download sequence
Identical sequences G1QI78
ENSNLEP00000000621 ENSNLEP00000000621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]