SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000654 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000654
Domain Number 1 Region: 4-220
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.31e-22
Family Glyoxalase I (lactoylglutathione lyase) 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000654   Gene: ENSNLEG00000000533   Transcript: ENSNLET00000000697
Sequence length 298
Comment pep:known_by_projection supercontig:Nleu1.0:GL397491.1:664862:689419:-1 gene:ENSNLEG00000000533 transcript:ENSNLET00000000697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARRALHFVFKVGDRFQTARFYRDVLGMKVLRHEEFEEGCKAACNGPYDGKWSKTMVGF
GPEDDHFVAELTYNYGIGDYKLGNDFMGITLASSQAVSNARKLEWPVTEVAEGVFETEAP
GGYKFYLQNRSLPQSDPVLKVTLAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADN
QCKLELQGIKGAVDHAAAFGRIAFSCPQKELPDLEDLMKRENQKILTPLVSLDTPGKATV
QVVILADPDGHEICFVGDEAFRELSKMDPEGGKLLDDAMAADKSDEWFAKHNKPKASG
Download sequence
Identical sequences ENSNLEP00000000654 ENSNLEP00000000654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]