SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001059 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001059
Domain Number 1 Region: 110-338
Classification Level Classification E-value
Superfamily L domain-like 7.94e-49
Family Ngr ectodomain-like 0.01
Further Details:      
 
Domain Number 2 Region: 408-712
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.65e-42
Family Rhodopsin-like 0.00066
Further Details:      
 
Domain Number 3 Region: 38-77
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000126
Family LDL receptor-like module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001059   Gene: ENSNLEG00000000880   Transcript: ENSNLET00000001121
Sequence length 751
Comment pep:known_by_projection supercontig:Nleu1.0:GL397329.1:4671325:4734554:1 gene:ENSNLEG00000000880 transcript:ENSNLET00000001121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSGFKHLFSLRLITMFFLLHFIVLINVKDFALTQGSMITPSCQKGYFPCGNLTKCLPRAF
HCDGKDDCGNGADEENCGDTSGWATIFGTVHGNANTVALTQECFLKQYPQCCDCKETELE
CVNDDLKSVPMISNNVTLLSLKKNKIHSLPDKVFIKYTKLKKIFLQHNCIRHISRKAFFG
LYNLQILYLNHNCITTLRPGIFKDLHQLTWLILDDNPITRISQRLFTGLNSLFFLSMVNN
YLEALPKQMCAQMPQLNWVDLEGNRIKYLTNSTFLSCDSLSVLFLPRNQIGFVPEKTFSS
LKNLGELDLSSNMITELSPHLFKDLKLLQKLNLSSNPLMYLHKNQFESLKQLQSLDLESI
EIPNINTRMFQPMKNLSHIYFKNFRYCSYAPHVRICMPLTDGISSFEDLLANNILRIFVW
VIAFITCFGNLFVIGMRSFIKAENTTHAMSIKILCCADCLMGVYLFFVGFFDIKYRGQYQ
KYALLWMESVQCRLMGFLAMLSTEVSVLLLTYLTLEKFLVIVFPFSNIRPGKRQTSVILI
CIWMAGFLIAVIPFWNEDYFGNFYGKNGVCFPLYYDQTEDIGSKGYSLGIFLGVNLLAFL
IIVFSYITMFCSIQKTALQTTEVRNRFGREVAVANRFFFIVFSDAICWIPVFVIKILSLF
RVEIPDTVTSWIVIFFLPVNSALNPLLYTLTTSLFKDKLKQLLHKHRRKSIFKIKKKSLS
TSIVWIEDSSSLKLGVLNKITLGDSIMKPVS
Download sequence
Identical sequences ENSNLEP00000001059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]