SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001062 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001062
Domain Number 1 Region: 218-381,414-476
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.02e-38
Family Voltage-gated potassium channels 0.0034
Further Details:      
 
Domain Number 2 Region: 481-663
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.24e-36
Family cAMP-binding domain 0.00093
Further Details:      
 
Domain Number 3 Region: 39-135
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.5e-20
Family Flavin-binding PAS domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001062   Gene: ENSNLEG00000000890   Transcript: ENSNLET00000001124
Sequence length 1108
Comment pep:known_by_projection supercontig:Nleu1.0:GL397300.1:1988467:2370666:-1 gene:ENSNLEG00000000890 transcript:ENSNLET00000001124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVMKGLLAPQNTFLDTIATRFDGTHSNFILANAQVAKGFPIVYCSDGFCELAGFARTEV
MQKSCSCKFLFGVETNEQLMLQIEKSLEEKTEFKGEIMFYKKSGSPFWCLLDIVPIKNEK
GDVVLFLASFKDITDTKVKITPEDKKEDKVKGRSRAGTHFDSARRRSRAVLYHISGHLQR
REKNKLKINNNVFVDKPAFPEYKVSDAKKSKFILLHFSTFKAGWDWLILLATFYVAVTVP
YNVCFIGNDDLSTTRSTTVSDIAVEILFIIDIILNFRTTYVSKSGQVIFEARSICIHYVT
TWFIIDLIAALPFDLLYAFNVTVVSLVHLLKTVRLLRLLRLLQKLDRYSQHSTIVLTLLM
SMFALLAHWMACIWYVIGKMEREDNSLLKWEVGWLHELGKRLESPYYGNNTLGGPSIRSA
YIAALYFTLSSLTSVGFGNVSANTDAEKIFSICTMLIGALMHALVFGNVTAIIQRMYSRW
SLYHTRTKDLKDFIRVHHLPQQLKQRMLEYFQTTWSVNNGIDSNELLKDFPDELRSDITM
HLNKEILQLSLFECASRGCLRSLSLHIKTSFCAPGEYLLRQGDALQAIYFVCSGSMEVLK
DSMVLAILGKGDLIGANLSIKDQVIKTNADVKALTYCDLQCIILKGLFEVLDLYPEYAHK
FVEDIQHDLTYNLREGHESDVISRLSNKSTVSQSEPKGNGSINKRLPSIVEDEEEEEEGE
EEEAVSLSPICTRGSSSRNKKVGSNKTYLGLSLKQLASGTVPFHSPIRVSRSNSPKTQPE
IDPPNHNKRKEKNLKLQLSTLNNAGPPDLSPRIVDGIEDGNSSEESQTFDFGSERIRSEP
RISPPLGDPEIGAAVLFIKAEETKQQINKLNSEVTTLTQEVSQLGKDMRNVIQLLENVLS
PQQPSRFCSLHSTSVCPSRESLQTRMSWSAHQPCLHLQTGGAAYTQAQLCSSNITSDIRS
VDPSSVGSSPQRTGAHEQNPADSELYHSPSLDYSPSHYQVVQEGHLQFLRCISPHSDSTL
TPLQSISATLSSSSVCSSSETSLHLVLPSRSEEGSFSQGTVSSFSLENLPGSWNQEGMAS
ASTKPLENFPLEVVTSTAEVKDNKAINI
Download sequence
Identical sequences A0A2I3GWX5
XP_003265290.1.23891 ENSNLEP00000001062 ENSNLEP00000001062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]