SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001220 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001220
Domain Number 1 Region: 489-977
Classification Level Classification E-value
Superfamily ALDH-like 9.16e-165
Family ALDH-like 0.000000000769
Further Details:      
 
Domain Number 2 Region: 77-277
Classification Level Classification E-value
Superfamily Formyltransferase 1.15e-50
Family Formyltransferase 0.0000000024
Further Details:      
 
Domain Number 3 Region: 281-382
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 1.05e-25
Family Post formyltransferase domain 0.00000117
Further Details:      
 
Domain Number 4 Region: 401-483
Classification Level Classification E-value
Superfamily ACP-like 0.00000648
Family Acyl-carrier protein (ACP) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001220   Gene: ENSNLEG00000000948   Transcript: ENSNLET00000001291
Sequence length 978
Comment pep:known_by_projection supercontig:Nleu1.0:GL397380.1:4345205:4424900:-1 gene:ENSNLEG00000000948 transcript:ENSNLET00000001291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAPTRLTLRPPRAPPLTGSGLNQSSRTGGDRSHLLAPRTGLHQPQFRGCGSQKSSLPG
TPAPTPARGPSNPPAAMKIAVIGQSLFGQEVYCHLRKEGHEVVGVFTVPDKDGKADPLGL
EAEKDGVPVFKFSRWRAKGQALPDVVAKYQALGAELNVLPFCSQFIPMEIINAPQHGSII
YHPSLLPRHRGASAINWTLIHGDKKGGFSIFWADDGLDTGDLLLQKECEVLPDDTVSTLY
NRFLFPEGIKGMVQAVRLIAEGKAPRLPQPEEGATYEGIQKKESAKINWDQPAEAIHNWI
RGNDKVPGAWTEAGEQKLTFFNSTLNTSGLVPEGDALPIPGAHRPGVVTKAGLILFGNDD
KMLLVKNIQLENGKMILASNFFKGAASSALELTEAELVTAEAVRSVWQRILPNVLEVEDS
TDFFKSGAASVDVVRLVEEVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEEGEC
SIDYVEMAVNKRTVRMPHQLFIGGAFVDAEGAKTSESINPTDGSVICQVSLAQVTDVDKA
VAAAKDAFENGRWGKISARDRGRLLYRLADLMEQHQEELATIEALDAGAVYTLALKTHVG
MSIQTFRYFAGWCDKIQGSTIPINQARPNRNLTLTRKEPVGVCGIIIPWNYPLMMLSWKT
AACLAAGNTVVIKPAQVTPLTALKFAELTLKAGIPKGVVNILPGSGSLVGQRLSDHPDVR
KIGFTGSTEVGKHIMKSCAISNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKG
ENCIAAGRLFVEDSIHDEFVRRVVEEVRKMKVGNPLDRDTDHGPQNHHAHLMKLLEYCQR
GVKEGATLVCGGNQVPRPGFFFEPTVFTDVEDHMFIAKEESFGPVMIISRFADGDVDAVL
SRANATEFGLASGVFTRDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDL
GEAALNEYLRVKTVTFEY
Download sequence
Identical sequences XP_003275608.2.23891 ENSNLEP00000001220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]