SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001221 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001221
Domain Number 1 Region: 2-474
Classification Level Classification E-value
Superfamily ALDH-like 1.96e-169
Family ALDH-like 0.0000000000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001221   Gene: ENSNLEG00000001039   Transcript: ENSNLET00000001292
Sequence length 478
Comment pep:known_by_projection supercontig:Nleu1.0:GL397416.1:2835240:2864082:1 gene:ENSNLEG00000001039 transcript:ENSNLET00000001292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFINNEWHESKSGKKFATYNPSTLEKICEVEEGDKPDVDKAVEAAQAAFQRGSPWRRLDA
LSRGRLLHQLADLVERDRAALAALETMDTGKPFLHAFFIDLEGCIRTLRYFAGWADKIQG
KTIPTDDNVVCFTRHEPIGVCGAITPWNFPLLMLVWKLAPALCCGNTMVLKPAEQTPLTA
LYLGSLIKEAGFPPGVVNIVTGFGPTVGAAISSHPQINKIAFTGSTEVGKLVKEAASRSN
LKRVTLELGGKNPCIVCADADLDLAVECAHQGVFFNQGQCCTAASRVFVEEQVYSEFVRR
SVEYAKKRPVGDPFDVKTEQGPQIDQKQFDKILELIESGKKEGAKLECGGSAMEDKGLFI
KPTVFSEVTDNMRIAKEEIFGPVQPILKFKSIEEVIKRANSTDYGLTAAVFTKNLDKALK
LASALESGTVCIRTVSIQWLRDMPILNFPLFCDHRGEYALAEYTEVKTVTIKLGDKNP
Download sequence
Identical sequences ENSNLEP00000001221 ENSNLEP00000001221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]