SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001263 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001263
Domain Number 1 Region: 360-710
Classification Level Classification E-value
Superfamily Urocanase 8.37e-110
Family Urocanase 0.00000773
Further Details:      
 
Domain Number 2 Region: 85-301
Classification Level Classification E-value
Superfamily Urocanase 3.66e-70
Family Urocanase 0.0000333
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001263   Gene: ENSNLEG00000001076   Transcript: ENSNLET00000001337
Sequence length 735
Comment pep:known_by_projection supercontig:Nleu1.0:GL397380.1:4677626:4713879:-1 gene:ENSNLEG00000001076 transcript:ENSNLET00000001337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLQALCSGLPLRPLPENRGRQAGVPHAPVRTPGLSPAEKQLALRNALRYFPPDVQKLL
APEFAQELQLYGHIYMYRFCPDIEMRAYPIELYPCQTKAAAAIMHMIMNNLDPAVAQFPQ
ELVTYGGNGQVFSNWAQVLHTXXXXXXXXXXXXXXXXXXXXXRPLSSSRSATRLVITNGM
VIPNYSSRTEYEKLFALGVTMYGQMTAGSYCYIGPQGIVHGTVLTVLNAARRYLGIEDLA
GKVFVTSGLGGMSGAQAKAAVIVGCIGVIAEVDKAALEKRHKQGWLMEVTDSLDRCIQRL
RVLQLGLQQAPGWAGLPASLELCVLSYFANLAALGEGRCLAPSGFSRPLPGTPVLLLCPS
REARKKNEVLSLGYHGNVVALWERLVHELDTTGECLVDLGSDQTSCHNPFNGGYYPVQLS
FTEAQSLMASNPAVFKDLVQESLRRQVSAINRLAEEKFFFWDYGNAFLLEAQRASDVEKK
GAGRTEFRYPSYVQHIMGDIFSQGFGPFRWVCTSGDPQDLVVTDELATSVLEEAIADGVK
ASVKLQYMDNIRWIREAARHRLVRAQAWEPMREEEAARLIVPAKAELAVRCTAASAPVVL
SRDHHDVSGTDSPFRETSNIYDGSAFCADMAVQNFVGDACRGATWVALHNGGGVGWGEVI
NGGFGLVLDGTPEAEQRARLMLSWDVSNGVARRCWSGNQKAYEIICQTMQENSSLVVTLP
HKVEDERVLQQALQL
Download sequence
Identical sequences ENSNLEP00000001263 ENSNLEP00000001263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]