SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001321 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001321
Domain Number 1 Region: 400-437,475-579,693-808
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.18e-51
Family Phosphate binding protein-like 0.0000734
Further Details:      
 
Domain Number 2 Region: 286-391
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.000000133
Family L-arabinose binding protein-like 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000001321
Domain Number - Region: 571-669
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00294
Family Voltage-gated potassium channels 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001321   Gene: ENSNLEG00000001124   Transcript: ENSNLET00000001399
Sequence length 877
Comment pep:known_by_projection supercontig:Nleu1.0:GL397406.1:737322:746874:1 gene:ENSNLEG00000001124 transcript:ENSNLET00000001399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFVRALWLGLALALGPGSAGGHPQPCGVLARLGGSVRLGALLPRAPFARARVRAALARA
ALAPRLPHNLSLELVVAATPARDPASLARGLCQALAPPGVAALLAFPEARPELLQLHFLA
AATETPVLSLLRREARAPLGAPNPFHLQLHWASPLETLLDVLVAVLQAHAWEDVGLALCR
TQDPGGLVALWTSRAGRPPQLVLDLSRRDTGDVGLRARLAPMGAPVGGEAPVPAAVLLGC
DIARARRVLGAVPPGPHWLLGTPLPPKALPTAGLPPGLLALGEVAQPPLEAAIHDTVQLV
ARALGSAAQVQPENVLLPAAVNCGDLRPAGPESPGRFLARFLANTSFQGRTGPVWVTGSS
QVHTSRRFKVWSLRRDPRGAPAWATVGSWRDGQLDLEPGGASARPPPPPGAQARPKLRVV
TLVEHPFVFARDPDEDGQCPAGQLCLDPGTNDSATLDALFAELANGSVPRALRKCCYGYC
IDLLERLAEDTPFDFELYIVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSINSARSQ
VVDFTSPFFSTSLGIMVRARDTASPIGAFMWPLHWSMWLGIFAALHLTALFLTLYEWRSP
YGLTPRGRNRSTVFSYSSALNLCYAILFGRTVSSKTPKCPTGRLLMNLWAIFCLLVLSSY
TANLAAVMVGDKTFEELSGIHDPKLHHPAQGFRFGTVWESSAEAYIKKSFPEMHAHMRRH
SAPTTPHGVAMLTSDPPKLNAFIMDKSLLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQN
SPLTSNLSEFISRYKSSGFIDLLHDKWYKMVPCGKRVFAVTETLQMSIYHFSGLFVLLCL
GLGSALLSSLGEHAFFRLALPRIRKGSRLQYWLHTSQ
Download sequence
Identical sequences ENSNLEP00000001321 ENSNLEP00000001321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]