SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001473 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001473
Domain Number 1 Region: 2039-2314
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.64e-60
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.000000000184
Further Details:      
 
Domain Number 2 Region: 26-225
Classification Level Classification E-value
Superfamily Thiolase-like 1.57e-50
Family Thiolase-related 0.0009
Further Details:      
 
Domain Number 3 Region: 312-437,500-596
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.14e-39
Family FabD-like 0.0076
Further Details:      
 
Domain Number 4 Region: 1456-1617
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.62e-35
Family Alcohol dehydrogenase-like, C-terminal domain 0.00017
Further Details:      
 
Domain Number 5 Region: 1698-1890
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.26e-29
Family Tyrosine-dependent oxidoreductases 0.00036
Further Details:      
 
Domain Number 6 Region: 1030-1218
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 6.52e-17
Family UbiE/COQ5-like 0.074
Further Details:      
 
Domain Number 7 Region: 1372-1491
Classification Level Classification E-value
Superfamily GroES-like 0.0000000000000288
Family Alcohol dehydrogenase-like, N-terminal domain 0.0078
Further Details:      
 
Domain Number 8 Region: 1938-2002
Classification Level Classification E-value
Superfamily ACP-like 0.00000000000615
Family Acyl-carrier protein (ACP) 0.00025
Further Details:      
 
Domain Number 9 Region: 437-493
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0000000615
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001473   Gene: ENSNLEG00000001247   Transcript: ENSNLET00000001555
Sequence length 2324
Comment pep:novel contig::ADFV01138679.1:7538:14593:-1 gene:ENSNLEG00000001247 transcript:ENSNLET00000001555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PATIVGGINILLKPNTSVQFLRLGMLSPEGTCKAFDAAGNGYCRSEGVVAVLLTKKSLAW
RVYATILNAGTNTDGFKEQGVTFPSGDIQEQLIRSLYQSAGVAPESFEYIEAHGTGTKVG
DPQELNGITRALCTTRQEPLLICSTKSNMGHPEPVSGLAALAKMLLSLEHGLWAPNLHFH
SPSPEIPVLLDGRLQVVAQPLPVCGGNVGINSFGFRGSKVHVFLRPNTQLPPAPTPHATL
PRLLRASGRTPEAMQKLLEQGLQHSQDLAFLSMLNDIAAVPTTTMPFHGYAVLGGECGGP
EVQQVPAGERPLWFICSGMGTQWCRMGLSLMHLDCFRDSILRSDEAVKPFGLKVSQLLLS
TDESTFDDIVHAFVSLTAIQIGLIDLLSCMGLRPDGIIGHSLGEVACGYADGCLSQEEAV
LATYWRGQCIKEAHLLPGAMAAVGLSWEECKQCCPPGVVPACHNSKDTVTISGPQALVFE
FVEQLRKEGVFAKEVRTGSMAFHSYFMEAIAPPLLQALKKVIREPKPRSARWLSTSIPEA
QWHSSLARTSSAEYNVNNLVSPVLFQEALWHMPEHAVVLEIPPHALLQAVLKRGLKLSCT
IIPLMKKDHRDNLEFFLAGIGRLNLSGIDANPNALFPPVEFPAPRGTPLISPLIKWDHSL
AWDVPAAEDFPNGSGSPSAAVYNIDTSSESPDRYLVDHTLDGPIIFPATGYPSIVWKTLG
RALGLAIEQLPVVFEDVVLHQATILPKTGTVSLEVRLLEASCTFEVSENGNLIVSGKVYQ
WDDPDPRLFDHLESPTPNPAEPLFLAQAEVYRELRLCGYNYSPHCQGTLEASLEGDSGRL
LWKDNWVSFMDTMLQMSILGSAKHGLHLPTRITTVHIDPATHRQKLYTLQDKAQVADVVV
SRWLSVTVAGGVHISRLHTELALRRQQEQQVPILEFCFTPHMEEGCLSERAALQEELQLC
NGLAQALQTKVTQQGQKMAVPGLHGARVPQDPSQQELPRLLWAACRLQLNGNLQLELAQV
LAQERPKLPEDPLLSGLLDSPALKACLDAALENMPSPKMKVVEVLAGHSHLYSRIPGLLS
PHPLLQLSYTATDCHPQALEAAQAELQQHDVAQGQWDPVDPAPSALGSADLLVCNCAVAA
LGDLASALSNMVAALREGGFLLLHTLLWGHPLGDAMAFLTSTEPQYSQGILSQDAWESLF
SRVSLRLVGLKKSFYGSTLFLCRPAPQDSPIFLPVQDTSFCLVESLKGILADKDSSRPVW
LKAINCATSGVVSLVNCLRQEPGGHRLRCVLLSNLSSTSCVQEVDPGFAELQKVLQGDLV
MNVYCDGAWGAFRHFLLEEDKPEEPTAYAFVTTLTRGDLSSICWVCFSLRHAQPTRPGQL
CTVYYASLNFHDIMLATGKLSPDAIPGKWTSQDNLLGMEFSGRDASGKSVMGLVPAEGLA
TSVLLSPDILWDVPSNWTLEEVASVPVVCSTAYYALVVRGRVRPGETVLIHSGSGGVGQA
TIALSLGCRVFTTVGSAEKRAYLQARFPQLDSTSFANSRDTSFEQHVLWHTGGKGVDLFL
NSLAEEKLQASVRCLAMHGRFLEIGKFDLSQNHPLGMAIFLKNVTFHGILLDAFFNESSA
DWRKVSALVQAGIRDGVVRPLKCTVFPGAQGEDAFRYMAQGKHIGKVVVQVLAEESEAVL
KGAKPKLMSAISKTFCPAHKSYVITGGLGGILELAQWLIQRGVQKLVLTSRSGIRTGYQA
KQVRRWRRQDVQVQVSTSNISSLEGAQGLIAEAAQLGPVGGVFNLAMVLRDAMLENQIPE
FFQDVCKPKYRGTLNLDRVTREACPELDYLVVFSSVSSGRGNAGQSNYGFANSAMERICE
KRRHEGLPGLAVQWGAIGDVGLLAEMTSINDTVISGTLPQRMASCLEVLDLLLNQPHMGL
SSFVLVEKAAAYGDRDSQQDLVEAVAHILGIRDLAAVNLDSSLADLGLDSLMSVEVRQTL
ERELNLVLSVRDVRQLTLWKLQELSSKADAANELASPTPKEDGLAQQQTQLNLRSLLVNP
EGPTLMRLNSLQSSERPLFLVHPIDGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLA
AYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCFQLQAQQSPAPTHNSLFLFDGSPTYVLA
YTQSYRVKLTPGCEAEAETEAICFFVQQFTDMEHNTVLEALLPLKGLEERVAAAVDLIFK
SHQGLDRQELSFAALSFYYKLRAAEQYTPKAKYHGNVMLLRAKMGGAYGEDLGADYNLSQ
VCDGKVSVHVIGDHCTLLEGSGLESIVSIIHSSLAEPRVSVREG
Download sequence
Identical sequences ENSNLEP00000001473 ENSNLEP00000001473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]