SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001477 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001477
Domain Number 1 Region: 461-659
Classification Level Classification E-value
Superfamily Hemopexin-like domain 9.81e-67
Family Hemopexin-like domain 0.00000000218
Further Details:      
 
Domain Number 2 Region: 88-217,390-445
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.04e-38
Family Matrix metalloproteases, catalytic domain 0.000000395
Further Details:      
 
Domain Number 3 Region: 336-392
Classification Level Classification E-value
Superfamily Kringle-like 2.06e-21
Family Fibronectin type II module 0.0000635
Further Details:      
 
Domain Number 4 Region: 276-333
Classification Level Classification E-value
Superfamily Kringle-like 4.28e-21
Family Fibronectin type II module 0.0000526
Further Details:      
 
Domain Number 5 Region: 220-275
Classification Level Classification E-value
Superfamily Kringle-like 3.43e-20
Family Fibronectin type II module 0.0000528
Further Details:      
 
Domain Number 6 Region: 43-106
Classification Level Classification E-value
Superfamily PGBD-like 2.2e-17
Family MMP N-terminal domain 0.0000461
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001477   Gene: ENSNLEG00000001210   Transcript: ENSNLET00000001560
Sequence length 659
Comment pep:known_by_projection supercontig:Nleu1.0:GL397289.1:7789417:7817505:1 gene:ENSNLEG00000001210 transcript:ENSNLET00000001560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALMARGALTGALRALCLLGCLLSQAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGC
PKECNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVAQLTFFPRKPKWDK
NQITYRIVGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDG
YPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNG
KEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTS
YDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYE
SCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALM
APIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGISQI
RGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYW
IYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYKEVKKKMDPG
FPKLIADAWNAIPDNEDAVVDLQGSGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
Download sequence
Identical sequences ENSNLEP00000001477 ENSNLEP00000001477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]