SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001496 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001496
Domain Number 1 Region: 957-1124
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-80
Family Thrombospondin C-terminal domain 0.0000000509
Further Details:      
 
Domain Number 2 Region: 26-226
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-37
Family Laminin G-like module 0.0000163
Further Details:      
 
Domain Number 3 Region: 834-956
Classification Level Classification E-value
Superfamily TSP type-3 repeat 4.71e-35
Family TSP type-3 repeat 0.000000594
Further Details:      
 
Domain Number 4 Region: 766-837
Classification Level Classification E-value
Superfamily TSP type-3 repeat 4.45e-17
Family TSP type-3 repeat 0.00023
Further Details:      
 
Domain Number 5 Region: 493-544
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.7e-16
Family TSP-1 type 1 repeat 0.00012
Further Details:      
 
Domain Number 6 Region: 436-491
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000106
Family TSP-1 type 1 repeat 0.0000813
Further Details:      
 
Domain Number 7 Region: 693-777
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000144
Family TSP type-3 repeat 0.00013
Further Details:      
 
Domain Number 8 Region: 382-430
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000034
Family TSP-1 type 1 repeat 0.00095
Further Details:      
 
Domain Number 9 Region: 316-376
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000262
Family VWC domain 0.0036
Further Details:      
 
Domain Number 10 Region: 549-602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000137
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001496   Gene: ENSNLEG00000001271   Transcript: ENSNLET00000001581
Sequence length 1124
Comment pep:known_by_projection supercontig:Nleu1.0:GL397511.1:1053225:1082079:-1 gene:ENSNLEG00000001271 transcript:ENSNLET00000001581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWRLVLLALWVWPSTQAGHQDKDMTFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRF
DYIPPVNADDLSKITKIMRQKEGFFLTAQLKQDGKSRGTLLALEGPGLSQRQFEIVSNGP
ADTLDLTYWIDGTRHVVSLEDVGLADSQWKNVTVQVAGETYSLHVGCDLIDSFALDEPFY
EHLQAEKSRMYVAKGSARESHFRGLLQNVHLVFENSVEDILSKKGCQQGQGVEINAISEN
TETLRLGPHVTTEYVGPSAERRPEVCERSCEELGNMVQELSGLHVLVNQLSENLKESDDH
SFLWGGSLGGPPKNRTCSACWQDGRFFAEKKTWVVDSCTTCTLQRFKTICHQITCPPATC
ASPSFVEGECCPSCLHSVDGEEGWSPWAEWTECSVTCGSGTQQRGRSCDVTSNTCLGPSI
QTRACSLSKCDTRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPVPQMGGKNCKGSG
RETKACQGAPCPIDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQYGGKACVGDVQER
QMCNKRSCPVDGCLSNPCFPGAQCSSFPDGSWSCGSCPVGFLGNGTHCEDLDECALVPDV
CFSTSKVPRCVNTQPGFHCLPCPPRYRGSQPVGVGLEAAKTEKQVCEPENPCKDKTHNCH
KHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNLNLVCATNATYHCIKDNC
PHLPNSGQEDFDKDGIGDACDDDDDNDGVTDEKDNCQLLFNPRQADYDKDEVGDRCDNCP
YVHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPL
VHNPDQTDVDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNANQADHDRDGQGDACDPDD
DNDGIPDDRDNCRLVFNPDQEDLDGDGRGDICKDDFDNDNVPDIDDVCPENNAISETDFR
NFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDR
DDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPTRAYGYSGVSLKVVNSTTGTGEHLRN
ALWHTGNTPGQVRTLWHDPRNIGWKDYTAYRWHLTHRPKTGYIR
Download sequence
Identical sequences ENSNLEP00000001496 ENSNLEP00000001496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]