SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001515 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001515
Domain Number 1 Region: 50-187
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 5.84e-26
Family 4HBT-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001515   Gene: ENSNLEG00000001298   Transcript: ENSNLET00000001602
Sequence length 208
Comment pep:known_by_projection supercontig:Nleu1.0:GL397508.1:88978:99004:1 gene:ENSNLEG00000001298 transcript:ENSNLET00000001602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGLLVALLALGLAVFALLDGWYLVRLPCAVLRARLLQPRVRDLLAEQRFPGRVLPSDLD
LLLHMNNARYLREADFARVAHLTRCGVLGALRDLRAHTVLAASCARHRRSLRLLEPFEVR
TRLLGWDDRAFYLEARFVSLRDGFVCALLRFRQHLLGTSPERVVQHLCQRRVEPPELPVD
LQHWISYNEASSQLLRMESGLSDVTKDQ
Download sequence
Identical sequences G1QKR7
ENSNLEP00000001515 ENSNLEP00000001515 XP_003280784.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]