SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001547 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001547
Domain Number 1 Region: 74-130
Classification Level Classification E-value
Superfamily Kringle-like 8.57e-17
Family Fibronectin type II module 0.0051
Further Details:      
 
Domain Number 2 Region: 43-86
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000243
Family Fibronectin type II module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001547   Gene: ENSNLEG00000001326   Transcript: ENSNLET00000001635
Sequence length 131
Comment pep:known_by_projection supercontig:Nleu1.0:GL397725.1:52526:70405:-1 gene:ENSNLEG00000001326 transcript:ENSNLET00000001635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSLMLLFLETTNSSACIFPVCYFKYFFFYKTITHFPEVKDGECVFPFHYKNGTYYDCIK
SKARHKWCSLNKTYEGYWKFCSAEDFASCVFPFWYRRLIYWECTDHGDAFGKKWCSLTKN
FNKDRIWKYCE
Download sequence
Identical sequences ENSNLEP00000001547 ENSNLEP00000001547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]