SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001548 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001548
Domain Number 1 Region: 60-105
Classification Level Classification E-value
Superfamily Kringle-like 8.85e-17
Family Fibronectin type II module 0.0022
Further Details:      
 
Domain Number 2 Region: 2-51
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000343
Family Fibronectin type II module 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001548   Gene: ENSNLEG00000001333   Transcript: ENSNLET00000001637
Sequence length 105
Comment pep:known_by_projection supercontig:Nleu1.0:GL397725.1:97344:99598:1 gene:ENSNLEG00000001333 transcript:ENSNLET00000001637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EYGGNSLSKPCIFPSIYRNNVVSDCMEDESNKLWCPTTENMDKDGKWSFCADTRISVLVP
GFPCHFPFNYKNKNYFNCTNKGSKENLVWCATSYNYDQDHTWVYC
Download sequence
Identical sequences ENSNLEP00000001548 ENSNLEP00000001548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]