SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001555 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001555
Domain Number 1 Region: 210-348
Classification Level Classification E-value
Superfamily C-type lectin-like 1.61e-33
Family C-type lectin domain 0.00079
Further Details:      
 
Domain Number 2 Region: 350-487
Classification Level Classification E-value
Superfamily C-type lectin-like 3.37e-33
Family C-type lectin domain 0.00064
Further Details:      
 
Domain Number 3 Region: 949-1092
Classification Level Classification E-value
Superfamily C-type lectin-like 1.72e-27
Family C-type lectin domain 0.0036
Further Details:      
 
Domain Number 4 Region: 1396-1514
Classification Level Classification E-value
Superfamily C-type lectin-like 3.5e-27
Family C-type lectin domain 0.0026
Further Details:      
 
Domain Number 5 Region: 1533-1661
Classification Level Classification E-value
Superfamily C-type lectin-like 3.32e-26
Family C-type lectin domain 0.0007
Further Details:      
 
Domain Number 6 Region: 1107-1223
Classification Level Classification E-value
Superfamily C-type lectin-like 6.82e-26
Family C-type lectin domain 0.00087
Further Details:      
 
Domain Number 7 Region: 33-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.56e-25
Family Cysteine rich domain 0.009
Further Details:      
 
Domain Number 8 Region: 634-792
Classification Level Classification E-value
Superfamily C-type lectin-like 9.28e-25
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 9 Region: 1661-1794
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-22
Family C-type lectin domain 0.0033
Further Details:      
 
Domain Number 10 Region: 501-627
Classification Level Classification E-value
Superfamily C-type lectin-like 3.67e-19
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 11 Region: 1239-1359
Classification Level Classification E-value
Superfamily C-type lectin-like 8.4e-18
Family C-type lectin domain 0.0054
Further Details:      
 
Domain Number 12 Region: 154-210
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000131
Family Fibronectin type II module 0.0024
Further Details:      
 
Domain Number 13 Region: 799-932
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000000169
Family C-type lectin domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001555   Gene: ENSNLEG00000001178   Transcript: ENSNLET00000001644
Sequence length 1872
Comment pep:novel supercontig:Nleu1.0:GL397304.1:4986408:5130032:-1 gene:ENSNLEG00000001178 transcript:ENSNLET00000001644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTGWATPRRPAGLLMLLFCFLDLAEPSGRAANDPFTIVHGNTGKCIKPVYGWIVADDCD
ETEDKLWKWVSQHRLFHLHSQKCLGLDITKSVNEVRMFSCDSSAMLWWKCEHHSLYGAAR
YRLALKNGHGTAISNASDVWKKGGSEESLCDQPYHEIYTRDGNSYGRPCEFPFLIDGTWH
HDCILDEDHSGPWCATTLNYEYDRKWGICLKPENGCENNWEKNEQFGSCYQFNTQTALSW
KEAYVSCQNQGADLLSINSAAELTYLKEKEGIAKIFWIGLNQLYSARGWEWSDHKPLNFL
NWDPDRPSAPTIGGSSCARMDAESGLWQSFSCEAQLPYVCRKPLNNTVELTDVWTYSDTR
CDAGWLPNNGFCYLLVNESNSWDKAHAKCKAFSSDLISIHSLADVEVVVTKLHNEDIKEE
VWIGLKNINIPTLFQWSDGTEVTLTYWDENEPNVPYNKTPNCVSYLGELGQWKVQSCEEK
LKYVCKRKGEKLNDASSDKMCPPDEGWKRHGETCYKIYEDEVPFGTNCNLTITSRFEQEY
LNDLMKKYDKSLRKYFWTGLRDVDSRGEYNWATVGGRRRAVTFSNWNFLEPASPGGCVAM
STGKSIGKWEVKDCRSFKALSICKKMSGPLEPEEAAPKPDDPCPEGWQSFPASLSCYKVF
HAERIVRKRNWEEAERFCQALGAHLSSFSHLDEIKEFLHFLTGQFSDQRWLWIGLNKRSP
DLQGSWQWSDRTPVSTIIMPNEFQQDYDIRDCAAVKVFHRPWRRGWHFYDDREFVYLRPF
ACDTKLEWVCQIPKGRTPKTPDWYNPERAGIHGPPLIIEGSEYWFVADLHLNYEEAVLYC
ASNHSFLATITSFVGLKAIKNKIANISGDGQKWWIRISEQPIDDHFTYSRYPWHRFPMTF
GEECLYLSAKTWFIDLGKPTDCSTKLPFICEKYNVSSLEKYSPDSAAKVQCSEQWIPFQN
KCFLKIKPVSLTFSQASDTCHSYGGTLPSVLSQIEQDFITSLLPDMEATLWIGLRWTAYE
RMNKWTDNRELTYSNFHPLLVSRRLRIPENFFEEESRYHCALILNLQKSPFTGTWNFTSC
SERHFVSLCQKYSEVKGRQTLQNASETVKYLNNLYKIIPKTLTWHSAQRECLKSNMQLVS
ITDPYQQAFLSVQALLHNSSLWIGLFSQDDELNFGWSDGKRLHFSRWAETNGQLEDCVIL
DTDGFWKTADCNDNQPGAICYYSGNETEKEVKPVDSVKCPSPVLNTPWIPFQNCCYNFII
TKNRHMATIQDEVHSKCQKLNPKSHILSIRDEKENNFVLEQLLYFNYMASWVMLGITYGN
NSLMWSDKTPLSYTHWRAGRPTIKNEKFLAGLSTDGFWDIQTFNIIEETLYFHQHSILAC
KIEMVDYKEEYNTTLPQFMPYEDGIYSVIQKKVTWYEALNMCSQSGGHLASVHNQNGQLF
LEDIKRDGFPLWVGLSSHDGSESSFEWSDGSTFDYIPWKGQTSPGNCVLLDPKGTWKHEK
CNSVKDGAICYKPTKSKKLSRLTYSSRCPAAKENGSRWIQYKGHCYKSDQALHSFSEAKK
LCSKHDHSATIISIKDEDENKFVSRLMRENNNITMRVWLGLSQHSVDQSWSWLDGSEVTF
VKWENKSKSGVGKCSMLIASNETWKKVECEHGFGRVVCKVPLDCPSSTWIQFQDSCYIFL
QEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDA
SFKWFDNSSMTFDKWTDQDDDEDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYK
RKYLSDNHILVSALVIASTVILTVLGAIIWFLYKKHSDSRFTTVFSTAPQSPYNEDCVLV
VGEENEYPVQFE
Download sequence
Identical sequences ENSNLEP00000001555 ENSNLEP00000001555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]