SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001613 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001613
Domain Number 1 Region: 196-336
Classification Level Classification E-value
Superfamily C-type lectin-like 3.21e-41
Family C-type lectin domain 0.00034
Further Details:      
 
Domain Number 2 Region: 776-928
Classification Level Classification E-value
Superfamily C-type lectin-like 4.48e-40
Family C-type lectin domain 0.00049
Further Details:      
 
Domain Number 3 Region: 491-625
Classification Level Classification E-value
Superfamily C-type lectin-like 3.95e-38
Family C-type lectin domain 0.000000112
Further Details:      
 
Domain Number 4 Region: 346-484
Classification Level Classification E-value
Superfamily C-type lectin-like 1.99e-31
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 5 Region: 76-191
Classification Level Classification E-value
Superfamily C-type lectin-like 1.05e-29
Family C-type lectin domain 0.00099
Further Details:      
 
Domain Number 6 Region: 938-1063
Classification Level Classification E-value
Superfamily C-type lectin-like 1.23e-28
Family C-type lectin domain 0.0019
Further Details:      
 
Domain Number 7 Region: 648-771
Classification Level Classification E-value
Superfamily C-type lectin-like 1.19e-27
Family C-type lectin domain 0.0006
Further Details:      
 
Domain Number 8 Region: 2-57
Classification Level Classification E-value
Superfamily Kringle-like 1.57e-19
Family Fibronectin type II module 0.00074
Further Details:      
 
Domain Number 9 Region: 1066-1112
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000472
Family C-type lectin domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001613   Gene: ENSNLEG00000001315   Transcript: ENSNLET00000001706
Sequence length 1112
Comment pep:known_by_projection supercontig:Nleu1.0:GL397739.1:3454:79536:-1 gene:ENSNLEG00000001315 transcript:ENSNLET00000001706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMYTLLGNANGATCAFPFKFENKWYADCTSAGRSDGWLWCGTTTDYDTDKLFGYCPLKFE
GSESLWNKDPLTSISYQINSKSALTWHQARKSCQQQNAELLSFTEIHEQTYLTGLTSSLT
SGLWIGLNSLSFNSGWQWSDRSPFRYLNWLPGSPSAEPGKSCVSLNPGKYAKWENLECVQ
KLGYICKKGNTTLNSFVIPSESDVPTHCPSQWWPYAGHCYKIHRDEKKIQRDALTACRKE
GGDLASIHTIEEFDFIISQLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPS
HENNRQEDCVVMKGKDGHWADRGCEWPLGYICKMKSRSQGPEIVEVEKGCRKGWKKHHFY
CYMIGHTLSTFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKYFWTGLSDIQTKG
TFQWTIEEEVRFTHWNSDMPGRKPGCVAMRTGIAGGLWDVLKCDEKAKFVCKHWAEGVTH
PPKPTTTPEPKCPENWGASSRTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKE
EQQTIWRLITASGSYHELFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCG
ELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYF
TKRETMHARAFCKRNFGDLVSTIGTPYYALLFKYLVNRNDAQSAYFIGLLISLDKKFAWM
DGSKVDYVSWATGEPNFANEDENCVTMYSNSGFWNDINCGYPNAFICQRHNSSINATTVM
PTTPSVPSGCKEGWNFYNNKCFKIFGFFEEERKNWQEARKACIGFGGNLVSIQNEKEQAF
LTYHMKDSTFSAWTGLNDVNSEHTFLWTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVI
IGGASNEAGKWMDDTCDSKRGYICQTRSDPSLTNLPATIQTDGFIKYGKSSYSLMKQKFQ
WHEAETYCKLHNSLIASILDPYSNAFAWLQMETSKERVWIALNSNLTDNQYTWTDKWRVR
YTNWAADEPKLKSACVYLDLDGYWKTAHCNESFYFLCKRSDEIPATEPPQLPGRCPESDH
TAWIPFHGHCYYIESSYTRNWGQASLECLRMG
Download sequence
Identical sequences ENSNLEP00000001613 ENSNLEP00000001613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]