SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001645 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001645
Domain Number 1 Region: 1797-1931
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.88e-20
Family Growth factor receptor domain 0.0099
Further Details:      
 
Domain Number 2 Region: 782-913
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.02e-18
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 3 Region: 1719-1790
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.97e-18
Family TB module/8-cys domain 0.0000949
Further Details:      
 
Domain Number 4 Region: 621-689
Classification Level Classification E-value
Superfamily TB module/8-cys domain 7.85e-18
Family TB module/8-cys domain 0.0011
Further Details:      
 
Domain Number 5 Region: 2109-2245
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.42e-18
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 1611-1724
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.08e-17
Family Growth factor receptor domain 0.0069
Further Details:      
 
Domain Number 7 Region: 869-993
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.87e-17
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 8 Region: 1195-1268
Classification Level Classification E-value
Superfamily TB module/8-cys domain 9.16e-17
Family TB module/8-cys domain 0.0000647
Further Details:      
 
Domain Number 9 Region: 2004-2073
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.83e-16
Family TB module/8-cys domain 0.00051
Further Details:      
 
Domain Number 10 Region: 382-520
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.51e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 11 Region: 323-396
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.66e-16
Family TB module/8-cys domain 0.00074
Further Details:      
 
Domain Number 12 Region: 117-247
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.96e-16
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 13 Region: 1517-1642
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.26e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 14 Region: 201-328
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000122
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number 15 Region: 1355-1421
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000576
Family TB module/8-cys domain 0.00066
Further Details:      
 
Domain Number 16 Region: 1-66
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000746
Family TB module/8-cys domain 0.0019
Further Details:      
 
Domain Number 17 Region: 987-1121
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000228
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 18 Region: 1274-1329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000205
Family EGF-type module 0.00077
Further Details:      
 
Domain Number 19 Region: 697-750
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000628
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 20 Region: 1434-1559
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000942
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 21 Region: 2246-2361
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000146
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 22 Region: 1153-1199
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family EGF-type module 0.00049
Further Details:      
 
Domain Number 23 Region: 740-774
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000201
Family EGF-type module 0.001
Further Details:      
 
Domain Number 24 Region: 1115-1163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000204
Family EGF-type module 0.01
Further Details:      
 
Domain Number 25 Region: 1960-2007
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000321
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 26 Region: 1918-1956
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000686
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001645   Gene: ENSNLEG00000001354   Transcript: ENSNLET00000001741
Sequence length 2408
Comment pep:known_by_projection supercontig:Nleu1.0:GL397524.1:680508:753380:-1 gene:ENSNLEG00000001354 transcript:ENSNLET00000001741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DHQAGTCFSVLFGGRCAGDLAGHYTRRQCCCDRGRCWAAGPAPELCPPRGSNEFQQLCAQ
GLPLLPSHPGLFPGLLGFGSNGMGPPLGLARLNPHGSNVRGIPSLGPGNSNIGTATLNQT
IDICRHFTNLCLNGRCLPTPSSYRCECNVGYTQDVRGECIDVDECTSSPCHHGDCVNIPG
TYHCRCYPGFQATPTRQACVDVDECIVSGGLCHLGRCVNTKGSFQCVCNAGFELSPDGKK
CVDHNECATSTTCVNGVCLNEDGSFSCLCKPGFLLAPGGRYCMDIDECQTPGICVNGHCT
NTEGSFHCQCLGGLAVGTDGRRCVDTHVRSTCYGAIEKNSCARPFPGTVTKSECCCANPD
HSFGEPCQLCPAKNSAEFQALCSSGLGITMDGRDINECALDPEVCANGMCENLRGSYRCV
CNLGYEAGASGKDCTDVDECALNSLLCDNGWCQNSPGSYSCSCPAGFHFWQDTEICKDVD
ECLSSPCVNGVCQNLKGSYTCKCAPGSRLDPSGTICLDSTKGTCWLKQDSRCEGLMLDTS
GRLCVGESRRGPYTGPHVLPLFPPPAVTRGTGEIFYLFIFEMECCLCRPGWSANSAHSTL
PGSVWRKSPLFTLALDLTIDRCADVRLEPCFLRWDEDECGVTLPGKYRMDVCCCSIGAAW
GAECEACPDPESLEFASLCPQGLGFASQDFLSGRPFYKDVNECKVFPGLCMHGTCRNTVG
SFHCACAGGFALDAQERNCTDIDECRISPDLCGQGACVNTPGSFECECFPGYESGFMLMK
DCMDVDECARDPLLCRGGTCANTDGSYKCQCPPGHELTAEGTACEDIDECSLRDGLCPHG
QCVNVIGAFQCSCRAGFQGTPDRQGCVDINECRVRNGGCDVHCINTEGSYQCSCGQGYLL
MPDGRACADVDECEENPRVCDQGHCTNMPGGHRCLCYDGFMATPDMKTCVDVDECDLNPH
ICLHGDCENTKGSFVCHCQLGYMVRKGATGCSDVDECEVGGHNCDSHASCLNILGSFSCR
CLPGWVGDGFECHDLDECISQEHRCSPRGDCLNVPGSYRCTCRQGFAGDGFSCEDRDECA
ENVDLCDNGQCLNAPGGYRCECEMGFDPTEDHRACQDVDECAQGNLCAFGSCENLPGMFR
CICDGGYELDRGGGDCTDINECADPVNCINGLCINTPGSYLCSCPQDFELNPSGVGCVDT
RAGNCFLETHDRGDGGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPMANTTEYRTLCP
GGEGFQPNPITVILEDIDECQELPGLCQGGDCVNTFGSFQCECPPGYHLSEHTRICEDID
ECSTHSGICGPGTCYNTLGNYTCVCPAEYLQVNGGNNCMDMRKSACFRHYNGTCQNELVF
NMTRKMCCCSYNIGQAWNRPCEACPTPTSPDYQILCGNQAPGFLIDIHTGKPLDIDECGD
IPAICANGICINQIGSFRCECPTGFNYNSILLACEDVDECGSRESPCQQNADCINIPGSY
RCKCTRGYKLSPGGACVGRNECREIPNVCSHGDCMDTEGSYMCLCHRGFQASADQTLCMD
IDECDRQPCGNGTCKNIIGSYNCLCFPGFVVTHNGDCVDFDECTTLVGQVCRFGHCLNTA
GSFHCLCQDGFELTADGKNCVDTNECLSLAGTCLPGTCQNLEGSFRCICPPGFQVQSDHC
IDIDECSEEPNLCLFGTCTNSPGSFQCLCPPGFVLSDNGHRCFDTRESFCFTRFEAGKCS
VPKAFNTTKTRCCCSKRPGEGWGDPCELCPQEGSAAFQELCPFGHGAVPGPDDSREDVNE
CAENPGVCTNGVCVNTDGSFRCECPFGYSLDFTGINCVDIDECSVGHPCGQGTCTNVIGG
FECACPDGFEPGPMMTCEDIDECSLNPLLCAFRCHNTEGSYLCTCPAGYTLREDGAMCRD
VDECADGQQDCHARGMECKNLIGTFMCVCPPGMRPLPGSREGCTDDDECRAQPDLCVNGR
CVNTAGSFRCDCDEGFQPSPTLTECHDIRQGPCFAEVLQIMCQSLSSSSEAVTRAECCCG
GGRGWGPRCELCPLPGTSAYRKLCPHGSGYTAEGRGKKLGSLLRVICLHTVCVCSLNSPR
ECLSNPAPPHHTVLLDVDECSQVPKPCTFLCKNTKGSFLCSCPRGYLLEEDGRTCKDLDE
CTSRQHNCQFLCVNTVGAFTCRCPPGFTQRHQACFDNDECSAQPGPCGAHGHCHNTPGSF
RCECHQGFTLDSSGHGCEDVNECDGPHRCQHGCQNQLGGYRCSCPQGFTQHSQWAQCVDE
NECALSPPTCGSASCRNTLGGFRCVCPSGFDFDQALGGCQDVDECAGRRGPCSYSCANTP
GGFLCGCPQGYFRAGRGHCVSSLGFSPGPQDTPDKEELLSSEACYECKINGLSPRDRPRR
SAHRDHQV
Download sequence
Identical sequences ENSNLEP00000001645 ENSNLEP00000001645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]