SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001688 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001688
Domain Number 1 Region: 59-103
Classification Level Classification E-value
Superfamily Epsilon subunit of F1F0-ATP synthase C-terminal domain 3.66e-18
Family Epsilon subunit of F1F0-ATP synthase C-terminal domain 0.00016
Further Details:      
 
Domain Number 2 Region: 2-56
Classification Level Classification E-value
Superfamily Epsilon subunit of F1F0-ATP synthase N-terminal domain 0.0000000275
Family Epsilon subunit of F1F0-ATP synthase N-terminal domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001688   Gene: ENSNLEG00000001448   Transcript: ENSNLET00000001787
Sequence length 104
Comment pep:known_by_projection supercontig:Nleu1.0:GL397406.1:1047784:1053334:1 gene:ENSNLEG00000001448 transcript:ENSNLET00000001787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTGAFGILAAHVPTLQVLRPGLVVAKRWNLAISFLSSGSIAVNADSSVQLLAEEAVTLDM
LDLGAAKANLEKAQAELLGAADEATRAEIQIRIEANEALVKALE
Download sequence
Identical sequences ENSNLEP00000001688 ENSNLEP00000001688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]