SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001765 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001765
Domain Number 1 Region: 129-368
Classification Level Classification E-value
Superfamily vWA-like 1.02e-71
Family Integrin A (or I) domain 0.00000206
Further Details:      
 
Domain Number 2 Region: 1131-1315
Classification Level Classification E-value
Superfamily Fibronectin type III 5.41e-36
Family Fibronectin type III 0.00000288
Further Details:      
 
Domain Number 3 Region: 1527-1728
Classification Level Classification E-value
Superfamily Fibronectin type III 8.88e-35
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 4 Region: 993-1111
Classification Level Classification E-value
Superfamily CalX-like 5.49e-20
Family CalX-beta domain 0.00083
Further Details:      
 
Domain Number 5 Region: 625-710
Classification Level Classification E-value
Superfamily Integrin beta tail domain 3.53e-18
Family Integrin beta tail domain 0.0025
Further Details:      
 
Domain Number 6 Region: 27-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000272
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 7 Region: 538-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000276
Family Integrin beta EGF-like domains 0.019
Further Details:      
 
Domain Number 8 Region: 580-617
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family Integrin beta EGF-like domains 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000001765
Domain Number - Region: 508-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00363
Family Integrin beta EGF-like domains 0.045
Further Details:      
 
Domain Number - Region: 468-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0837
Family Integrin beta EGF-like domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001765   Gene: ENSNLEG00000001287   Transcript: ENSNLET00000001868
Sequence length 1823
Comment pep:known_by_projection supercontig:Nleu1.0:GL397452.1:876722:916822:1 gene:ENSNLEG00000001287 transcript:ENSNLET00000001868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPRPSPWARLLLAALISISLSGTLGNRCKKAPVKSCTECVRVDKDCAYCTDEMFRDRR
CNTQAELLAAGCQRESIVVMESSFQITEETQIDTTLRRSQMSPQGLRVRLRPGEERHFEL
EVFEPLESPVDLYILMDFSNSMSDDLDNLKKMGQNLAQVLSQLTRDYTIGFGKFVDKVSV
PQTDMRPEKLKEPWPNSDPPFSFKNVISLTEDVDEFRNKLQGERISGNLDAPEGGFDAIL
QTAVCTRDIGWRPDSTHLLVFSTESAFHYEADGANVLAGIVSRNDERCHLDATGTYTQYR
TQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHTYFPVSSLGVLQEDSSNIVELLE
EAFNRIRSNLDIRALDSPRGLRTEVTSKMFQKTKTGSFHIRRGEVGIYQVQLRAIEHVDG
THVCQLPGEDQKGNIHLKPSFSDGLKMDASIICDVCTCELQKEVRSARCSFNGDFMCGHC
VCSEGWSGQTCNCSTGSLSDIQPCLREGEDKPCSGRGECQCGQCVCYGEGRYEGQFCEYD
NFQCPRTSGFLCNDRGRCSMGQCVCEPGWTGPSCDCPLSNATCIDSNGGICNGRGHCECG
RCHCHQQSLYTDTICEINYSAIHPGLCEDLRSCVQCQVWGTGEKKGRMCEECNFKVKMVD
ELKRAKEVVVRCSFRDEDDDCTYSYTMEGDGAPGPNSTVLVHKKKDCPPGSFWWLIPLLL
LLLPLLALLLLLCWKYCACCKAACLALLPCCNRGCRHMVGFKEDHYMLRENMASDHLDTP
MLRSGNLKGRDVVRWKVTNNMQRPGFATHAASVNPTELVPYGLSLRLARLCTENLLKPDT
RECAQLRQEVEENLNEVYRQISGVHKLQQTKFRQQPNAGKKQDHTIVDTVLMAPRSAKPA
LLKLTEKQVEQRAFHDLKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDDE
KQLLVEAIDVPTGTATLGRRLVNITIIKEQARDVVSFEQPEFSVSRGDQVARIPVIRRVL
DGGKSQVSYRTQDGTAQGNRDYIPVEGELLFQPGEAWKELQVKLLELQEVDSLLRGRQVR
RFHVQLSNPKFGAHLGQPHSTTIIIRDPDELDRSFTSQMVSSQPPPHGDLGAPQNPNAKA
AGSRKIHFNWLPPSGKPMGYRVKYWIQGDSESEAHLLDSKVPSVELTNLYPYCDYEMKVC
AYGAQGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEICY
GLVNDDNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLA
TQPKRPMSSEWWAGRCGADRSGEDYDSFMYSDDVLRSPSGSQRPSVSDDTGCGWKFEPLL
GEELDLRRVTWRLPPELIPRLSASSGRSSDAEAPHGPPDDGGAGGKGGSLPRSATPGPPG
ASLAPAGLGCSEAGPSARVHRCTHTHACTHTDAHTHMHARTHMHTHTYTHTCMHTHTHAH
THTYAYTLPAPLTLVFLLSPDSRLTAGVPDTPTRLVFSALGPTSVRVSWQEPRCERPLQG
YSVEYQLLNGGELHRLNIPNPAQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIE
SQVHPQSPLCPLPGSAFTLSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDIVGYLVTCE
MAQGGGPATTFRVDGDSPESRLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQDG
GPFPQLGSHAGLFQHPLQSEYSSITTTHTSATEPFLVDGLTLGAQHLEAGGSLTRHVTQE
FVSRTLTTSGTLSTQVDQQFFQT
Download sequence
Identical sequences ENSNLEP00000001765 ENSNLEP00000001765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]