SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001905 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001905
Domain Number 1 Region: 79-147
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.06e-16
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 120-270
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000235
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 262-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000215
Family EGF-type module 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001905   Gene: ENSNLEG00000001599   Transcript: ENSNLET00000002015
Sequence length 439
Comment pep:known_by_projection supercontig:Nleu1.0:GL397418.1:771435:820331:1 gene:ENSNLEG00000001599 transcript:ENSNLET00000002015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPSSPRALFLLLLILACPEPRASQNCLSKQQLLSAIRQLQQLLKGQETRFAEGIRHMKS
RLAALQNSVSRVAPDAPPVSCPDLNTPADGRKFGSKYLVDHEVHFTCNPGFRLVGPSSVV
CLPNGTWTGEQPRCRDTSECSSQPCQNGGTCVEGVNQYRCICPPGRTGNRCQHQAQTAAP
EGSVAGDSAFSRAPRCAQVERAQHCSCEAGFHLSGAAGNSVCQDVNECELYGQEGRPRLC
MHACVNTPGSYRCTCPSGYRTLADGKSCEDVDECVGLQPVCPQGTTCINTGGSFQCVSPE
CPEGSGNVSYVKTSPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKTPITLFRMATA
SAPGRAGPNSLRFGIVGGNSRGHFVMQRSDRQTGELILVQTLEGPQTLEVDVDMSEYLDR
SFQANHVSKVTIFVSPYDF
Download sequence
Identical sequences G1QLT9
XP_003277721.1.23891 ENSNLEP00000001905 ENSNLEP00000001905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]