SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001920 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001920
Domain Number 1 Region: 134-205
Classification Level Classification E-value
Superfamily RILP dimerisation region 4.32e-18
Family RILP dimerisation region 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001920   Gene: ENSNLEG00000001614   Transcript: ENSNLET00000002030
Sequence length 211
Comment pep:known_by_projection supercontig:Nleu1.0:GL397391.1:329580:354315:-1 gene:ENSNLEG00000001614 transcript:ENSNLET00000002030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEPPVREEEEEEGEEDEERDEAGPEGALGKSPFQLTAEDVYDISYLLGRELMALGSDPR
VTQLQFKVVRVLEMLEALVNEGSLALEELKMERDNLRKEVEGLRRQSPPASGEVNLGPNK
MVVDLTDPNRPRFTLQELRDVLQERNKLKSQLLVVQEELQCYKSGLIPPREGPGGRREKD
AVVTRPNNAGRNKEEKTIIKKLFFFRSGKQT
Download sequence
Identical sequences G1QLV4
XP_003276276.1.23891 ENSNLEP00000001920 ENSNLEP00000001920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]