SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001987 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001987
Domain Number 1 Region: 60-278
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.49e-88
Family Calnexin/calreticulin 0.00000000256
Further Details:      
 
Domain Number 2 Region: 269-409
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 6.54e-59
Family P-domain of calnexin/calreticulin 0.0000000326
Further Details:      
 
Domain Number 3 Region: 412-456
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000237
Family Calnexin/calreticulin 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001987   Gene: ENSNLEG00000001508   Transcript: ENSNLET00000002098
Sequence length 592
Comment pep:known_by_projection supercontig:Nleu1.0:GL397464.1:979710:1013873:1 gene:ENSNLEG00000001508 transcript:ENSNLET00000002098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGKWLLWMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTY
KAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKESKLPGDKGL
VLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFH
DKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTL
ILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVK
PDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPKC
ESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPVS
AIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEER
PWLWVVYILTVALPVFLVILFCCSGKKQTSAMEYKKTDAPQPDVKEEEEEKEEEKDKGDE
EEEGEEKLEEKQKSDAEEDGGTVSQEEEDRKPRAEEDEILNRSPRNRKPRRE
Download sequence
Identical sequences G1QM21
XP_003279601.1.23891 XP_003279602.1.23891 XP_012360185.1.23891 ENSNLEP00000001987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]