SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002070 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002070
Domain Number 1 Region: 80-164
Classification Level Classification E-value
Superfamily DNA-binding domain 2.19e-28
Family Methyl-CpG-binding domain, MBD 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002070   Gene: ENSNLEG00000001734   Transcript: ENSNLET00000002184
Sequence length 169
Comment pep:novel supercontig:Nleu1.0:GL397406.1:1415794:1641959:-1 gene:ENSNLEG00000001734 transcript:ENSNLET00000002184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RWPAYASHGVKCGAGLARWKGRGRGRGRGRGAGGPGGHAGSSGDGGGCGGGQGQGGVAPR
REPFGAQVSGGEGAEEPGAMERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGK
KFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVK
Download sequence
Identical sequences ENSNLEP00000002070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]