SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002105 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002105
Domain Number 1 Region: 361-550
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.16e-35
Family Laminin G-like module 0.00000423
Further Details:      
 
Domain Number 2 Region: 564-764
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.34e-28
Family Laminin G-like module 0.0000412
Further Details:      
 
Domain Number 3 Region: 136-188
Classification Level Classification E-value
Superfamily GLA-domain 2.86e-20
Family GLA-domain 0.00039
Further Details:      
 
Domain Number 4 Region: 215-343
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000267
Family Growth factor receptor domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000002105
Domain Number - Region: 336-364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000369
Family EGF-type module 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002105   Gene: ENSNLEG00000001695   Transcript: ENSNLET00000002221
Sequence length 771
Comment pep:known_by_projection supercontig:Nleu1.0:GL397284.1:303285:402131:-1 gene:ENSNLEG00000001695 transcript:ENSNLET00000002221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQQCLLGLQHYSPSPSSQKLPGNVLVITSPLGLGAGSGRSPPPPAVPQRLSGSLAPPRS
TAQTEAHRLAAPRRRALRSPPRRATVPARASARFEMRVLGGRCGALLACLLLVLPVSEAN
FLSKQQASQVLVRKRRANSLLEETKQGNLERECIEELCNKEEAREVFENDPETDYFYPKY
LVCLRSFQTGLFTAARQSTNAYPDLRSCVNAIPDQCSPLPCNEDGYMSCKDGKASFTCTC
KPGWQGEKCEFDINECKDPSNINGGCSQICDNTPGSYHCSCKSGFVMLSNKKDCKDVDEC
SLKPSICGTAVCKNIPGGFECECPEGYRYNLKSKSCEDIDECSENMCAQLCVNYPGGYTC
YCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELLYLAEQFAGVVLYLKFRLPEISRFSA
EFDFRTYDSEGVILYAESIDHSAWFLIALRGGKIEIQLKNEHTSKITTGGDVINNGLWNM
VSVEELEHSISIKIAKEAVMDINKPGPLFKPENGLLETKVYFAGFPRKVESELIKPINPR
LDGCIRSWNLMKQGASGIKEIIQEKQNKHCLITVEKGSYYPGSGIAQFHIDYNNVSSAEG
WHVNVTLNIRPSTGTGVMLALVSGNNTVPFAVSLVDSTSEKSQDILLSVENTVIYRIQAL
SLCSDQQSHLEFRVNRNNLELSTPLKIETTSHEDLQRQLAILDKAMKAKVATYLGGLPDV
PFSATPVNAFYNGCMEVNINGVQLDLDEAISKHNDIRAHSCPSVWKKTKNS
Download sequence
Identical sequences XP_003261735.1.23891 XP_003261736.1.23891 ENSNLEP00000002105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]