SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002182 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002182
Domain Number 1 Region: 148-219,266-525
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 6.33e-93
Family NadC C-terminal domain-like 0.0000166
Further Details:      
 
Domain Number 2 Region: 15-147
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 2.5e-36
Family NadC N-terminal domain-like 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002182   Gene: ENSNLEG00000001703   Transcript: ENSNLET00000002298
Sequence length 565
Comment pep:known_by_projection supercontig:Nleu1.0:GL397508.1:877658:881269:-1 gene:ENSNLEG00000001703 transcript:ENSNLET00000002298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEQDPEGRAAARPLLTDLYQATMALGYWRAGRARDAAEFELFFRRCPFGGAFALAAGL
RDCVRFLRAFRLRDADVQFLASVLPPDTDPAFFEHLRALDCSEVTVRALPEGSLAFPGVP
LLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGPEKRLLEMGLRRAQGPDGGL
TASTYSYLGGFDSSSNVLAGQLRGVPVAGTLAHSFVTSFSGSEVPPDPMLAPAAGEGPGV
DLAAKAQVWLEHVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDSYSVWRSGLPNF
LAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQVSRGGESVPIAVSNNIDEE
ALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSK
AAFRLLGSDGSLLITLLQLAEEPAPQAGQELRVWPPGAQEPCTVRPAQVEPLLRLCLQQG
QLCEPLPSLAESRALAQLSLSQLSPEHRRLRSPAQYQVGGGPPCHSALCAPALPLPTAPL
LCSLQVVLSERLQALVNSLRAGPSP
Download sequence
Identical sequences ENSNLEP00000002182 ENSNLEP00000002182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]