SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002350 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002350
Domain Number 1 Region: 323-688
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.87e-65
Family Quinoprotein alcohol dehydrogenase-like 0.029
Further Details:      
 
Domain Number 2 Region: 67-265,319-400
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 1.18e-23
Family SGL-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002350   Gene: ENSNLEG00000001928   Transcript: ENSNLET00000002479
Sequence length 968
Comment pep:novel supercontig:Nleu1.0:GL397412.1:811740:834732:1 gene:ENSNLEG00000001928 transcript:ENSNLET00000002479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSLPGSAYCGRCRADPGEVPLWAAAGLSCGTRATAVMKFAYRFSNLLGTVYRRGNLNFT
CDGNSVISPVGNRVTVFDLKNNKSDTLPLATRYNVKCVGLSPDGRLAIIVDEGGDALLVS
LVCRSVLHHFHFKGSVHSVSFSPDGRKFVVTKGNIAQMYHAPGKKREFNAFVLDKTYFGP
YDETTCIDWTDDSRCFVIGSKDMSTWVFGAERWDNLIYYALGGHKDAIVACFFESNSLDL
YSLSQDGVLCMWQCDTPPEGLRLKPPAGWKADLLQREEEEEEEEDQEGDRETTIRGKATP
AEEEKTGKVKYSRLAKYFFNKEGDFNNLTAAAFHKKSHLLVTGFASGIFHLHELPEFNLI
HSLSISDQSIASVAINSSGDWIAFGCSGLGQLLVWEWQSESYVLKQQGHFNSMVALAYSP
DGQYIVTGGDDGKVKVWNTLSGFCFVTFTEHSSGVTGVTFTATGYVVVTSSMDGTVRAFD
LHRYRNFRTFTSPRPTQFSCVAVDASGEIVSAGAQDSFEIFVWSMQTGRLLDVLSGHEGP
ISGLCFNPMKSILASASWDKTVRLWDMFDSWRTKETLALTSDALAVTFRPDGAELAVATL
NSQITFWDPENAVQTGSIEGRHDLKTGRKELDKITAKHAAKGKAFTTLCYSADGQSILAG
GMSKFVCIYHVREQILMKRFEISCNLSLDAMEEFLNRRKMTEFGNLALIDQDAGQEDGVA
IPLNSTTLGDMSSRHFKPEIRVTSLHFSPTGRCWAATTTEGLLIYSLDTRVLFDPFELDT
SVTPGRVREALRQQDFTRAILMALRLNESKLVQEALEAVPRGEIEVVTSSLPELYVEKVL
EFLASSFEVSRHLEFYLLWTHKLLMLHGQKLKSRAGTLLPVIQFLQKSIQRHLDDLSKLC
SWNRYNMQYALAVSKQRGTKRSLDPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXE
MPLREVFT
Download sequence
Identical sequences ENSNLEP00000002350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]