SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002453 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002453
Domain Number 1 Region: 109-298,340-482
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4e-81
Family Quinoprotein alcohol dehydrogenase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002453   Gene: ENSNLEG00000001898   Transcript: ENSNLET00000002583
Sequence length 485
Comment pep:known_by_projection supercontig:Nleu1.0:GL397432.1:1107773:1118542:-1 gene:ENSNLEG00000001898 transcript:ENSNLET00000002583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVADEAVARDVQRLLVQFQDEGGQLLGSPFDVPVDITPDRLQLVCNALLAQEDPLPL
AFFVHDAEIVSSLGKTLESQAVETEKVLDIIYQPQAIFRVRAVTRCTSSLEGHSEAVISV
AFSPTGKYLASGSGDTTVRFWDLSTETPHFTCRGHRHWVLSISWSPDGKKLASGCKNGQI
LLWDPSTGKQVGRTLAGHSKWITGLSWEPLHANPECRYVASSSKDGSVRIWDTTAGRCER
ILTGHTQSVTCLRWGGDGLLYSASQDRTIKVWRARDGVLCRTLQGHGHWVNTMALSTDYA
LRTGAFEPAEASVNPQDLQGSLQELKERALSRYNLVRGQGPERLVSGSDDFTLFLWSPAE
DKKPLTRMTGHQALINQVLFSPDSRIVASASFDKSIKLWDGRMGKYLASLRGHVAAVYQI
AWSADSRLLVSGSSDSTLKVWDVKAQKLAMDLPGHADEVYAVDWSPDGQRVASGGKDKCL
RIWRR
Download sequence
Identical sequences G1QND7
XP_003278424.1.23891 ENSNLEP00000002453 ENSNLEP00000002453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]