SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002726 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000002726
Domain Number - Region: 106-157
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.000124
Family VPS37 C-terminal domain-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002726   Gene: ENSNLEG00000002279   Transcript: ENSNLET00000002872
Sequence length 284
Comment pep:known_by_projection supercontig:Nleu1.0:GL397506.1:1100747:1131363:-1 gene:ENSNLEG00000002279 transcript:ENSNLET00000002872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAGSEARFAGLSLVQLNELLEDEGQLTEMVQKMEETQNVQLNKEMTLASNRSLAEGNL
LYQPQLDTLKARLTQKYQELQVLFEAYQIKKTKLDRQSCSASLETLLALLQAEGAKIEED
TENMAEKFLDGELPLDSFIDVYQSKRKLAHMRRVKIEKQEMVLKGQRLPQALAPLPPRLP
ELAPTAPLPYPAPEASGPPAVAPRRIPPPPPPVPAGRLATPFTAAMSSGQAVPYPGLQCP
PLPPRVGLPTQQGFSSQFMSPYPPPLPQRPPPRLPPHQPGFILQ
Download sequence
Identical sequences G1QP60
ENSNLEP00000002726 ENSNLEP00000002726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]