SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002851 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002851
Domain Number 1 Region: 327-399
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 8.2e-22
Family Intermediate filament protein, coiled coil region 0.0016
Further Details:      
 
Domain Number 2 Region: 87-121
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000199
Family Intermediate filament protein, coiled coil region 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000002851
Domain Number - Region: 142-230
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00915
Family Myosin rod fragments 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002851   Gene: ENSNLEG00000002340   Transcript: ENSNLET00000002999
Sequence length 431
Comment pep:known_by_projection supercontig:Nleu1.0:GL397430.1:2875854:2882421:-1 gene:ENSNLEG00000002340 transcript:ENSNLET00000002999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSDCSSTHCSTESCTTASGCAPASSCSMETACLPGACATSQCQTPSFLSRSRGLTGCLL
PCYFTGSCNSCCSVGNCAWCEDGVFTSNEKETMQFLNDRLANYLEKVRSLEETNAELESR
IQAQCEQDIPMVCPNYQRYFNTIEDLQQKILCTKAENSRLAVQLDNCKLATDDFKSKYES
ELSLRQLLEADISSLHGILDELTLCKSDLEAHVESLKEDLLCLKKNHEEEVSLLRGQLGD
RLSVELDAAPTLDLNRVLDEMRCQYETVLANNRREAEEWFAVQTEELNQQQLSSAEQLQG
CQTEILELKRTANALEIELQAQQSLTESLECTVAETEAQYSSQLAQIQCLIDNVENQLAE
IRCDLERQNQKYQVLLDVKARLEGEINTYRGLLDSEDSRLSCNSCSTTCTSSNTCEPCSA
YVICTVENCCS
Download sequence
Identical sequences G1QPI5
ENSNLEP00000002851 XP_003278330.1.23891 ENSNLEP00000002851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]