SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002952 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002952
Domain Number 1 Region: 122-342
Classification Level Classification E-value
Superfamily vWA-like 1.06e-42
Family Integrin A (or I) domain 0.0000216
Further Details:      
 
Domain Number 2 Region: 614-690
Classification Level Classification E-value
Superfamily Integrin beta tail domain 3.4e-18
Family Integrin beta tail domain 0.0022
Further Details:      
 
Domain Number 3 Region: 360-445
Classification Level Classification E-value
Superfamily Integrin domains 4.24e-17
Family Integrin domains 0.0011
Further Details:      
 
Domain Number 4 Region: 22-81
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000575
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 5 Region: 528-568
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000145
Family Integrin beta EGF-like domains 0.001
Further Details:      
 
Domain Number 6 Region: 572-611
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000162
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000002952
Domain Number - Region: 493-521
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00474
Family Integrin beta EGF-like domains 0.019
Further Details:      
 
Domain Number - Region: 450-477
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0103
Family Integrin beta EGF-like domains 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002952   Gene: ENSNLEG00000002418   Transcript: ENSNLET00000003102
Sequence length 762
Comment pep:known_by_projection supercontig:Nleu1.0:GL397412.1:1536037:1563704:-1 gene:ENSNLEG00000002418 transcript:ENSNLET00000003102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGLRPPLLALVGLLSLGCVLSQECTKFKASSCRECIELGPGCTWCQKLNFTGPGDPDSI
RCDTRPQLLMRGCAADDILDPRSLAETQEDHDGGQKQLFPQKVTLYLRPGQAAVFNVTFR
RAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLQALNEITESGRIGFGSFVDKTVLPFV
NTHPEKLRNPCPNKEKECQPPFAFRHVLKLTNNSHQFQTEVGKQLIGNLDAPEGATDRGG
TALGPQNSGRESHTTLMTSADTGPPLSGADRGGHLEGLSRTQGQLSRTSCLQDYPSVGQL
AHKLAENNIQPIFAVTSRMVKTYEVSAVGVPKTTLGATSQELSRGPITLQHVWGKLSSRV
FLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFV
IRALGFTDTVTVRVLPQCECRCRDQSRDRSTCHGQGFLECGICRCDTGYIGKSCECQTQG
RSSQELEGSCRKDNNSMVCSGLGDCVCGQCLCHASDVQGKQIYGQYCECDTVSCERHNGQ
VCGGPDRGRCYCGKCLCSQGFEGSACQCERTTEGCLNPRRVECSGRGQCRCNVCECHSGY
QPPLCQECPGCASPCSKYISCAECLKFEKGPLGKNCSAACLDLQLRNNPVKGRTCKERDS
EGCWVTYTLEQQDGMGRYLIYVDESRECVAGPNIAAIVGGTVAGIVLIGILLLVIWKALI
HLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES
Download sequence
Identical sequences ENSNLEP00000002952 ENSNLEP00000002952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]