SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003136 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003136
Domain Number 1 Region: 32-128
Classification Level Classification E-value
Superfamily Kringle-like 5.32e-28
Family Kringle modules 0.00084
Further Details:      
 
Domain Number 2 Region: 216-323
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-25
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003136   Gene: ENSNLEG00000002586   Transcript: ENSNLET00000003295
Sequence length 492
Comment pep:known_by_projection supercontig:Nleu1.0:GL397272.1:1416972:1513789:1 gene:ENSNLEG00000002586 transcript:ENSNLET00000003295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPAARLALLSAAALTLAARPAPSPGLGPGPECFTANGADYRGTQNWTALQGGKPCLFW
NETFQHPYNTLKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPG
NLGCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKY
GEAASTECNSVCFGDHTQPCGGDGRIILFDTLVGACGGNYSAMSSVVYSPDFPDTYATGR
VCYWTIRVPGASRIHFSFPLFDIRDSADMVELLDGYTHRVLARFHGRSRPPLSFNVSLDF
VILYFFSDRINQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLY
VITTSPSHPPQTVPGSNSWAPPIGAGSHTVEGWTVYGLATLLILTVTAIVAKILLHITFK
SHRVPASGDLRDCHQPGTSGEIWSIFYKPSTSISIFKKKLKGQSQQDDRNPLAIQDSAVT
SLIWPQGQPRSI
Download sequence
Identical sequences G1QQB8
ENSNLEP00000003136 XP_003258088.1.23891 ENSNLEP00000003136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]