SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003142 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003142
Domain Number 1 Region: 325-381
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000000000425
Family VPS37 C-terminal domain-like 0.012
Further Details:      
 
Domain Number 2 Region: 62-130
Classification Level Classification E-value
Superfamily UBC-like 0.0000000017
Family UBC-related 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003142   Gene: ENSNLEG00000002558   Transcript: ENSNLET00000003302
Sequence length 397
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:4894619:4946989:1 gene:ENSNLEG00000002558 transcript:ENSNLET00000003302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWLFPLTKSASSSAAGSSGGLTSLQQQKQRLIESLRNSHSSIAEIQKDVEYRLPFTINN
LTININILLPPQFPQEKPVISVYPPIRHHLMDKQGVYVTSPLVNNFTMHSDLGKIIQSLL
DEFWKNPPVLAPTSTAFPYLYSNPSGMPPYASQGFPFLPPYPPQEANRSITSLSVADTVS
SSTTSHTTAKPAAPSFGVLSNLPLPIPTMDASISTSQNGFGYKMPDVPDAFPELSELSVS
QLTDMNEQEEVLLEQFLTLPQLKQIITDKDDLVKSIEELARKNLLLEPSLEAKRQTVLDK
YELLTQMKSTFEKKMQRQHELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKMEID
DFLSSFMEKRTICHCRRAKEEKLQQAIAMHSQFHAPL
Download sequence
Identical sequences A0A2I3GTP7
ENSNLEP00000003142 XP_003256754.1.23891 ENSNLEP00000003142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]