SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003146 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003146
Domain Number 1 Region: 81-311
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.73e-48
Family YicI N-terminal domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 312-477
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.98e-26
Family YicI catalytic domain-like 0.011
Further Details:      
 
Domain Number 3 Region: 40-94
Classification Level Classification E-value
Superfamily Trefoil 0.0000000000235
Family Trefoil 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003146   Gene: ENSNLEG00000002588   Transcript: ENSNLET00000003306
Sequence length 482
Comment pep:novel supercontig:Nleu1.0:GL397332.1:2423835:2457597:1 gene:ENSNLEG00000002588 transcript:ENSNLET00000003306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARKLRVLEVLLIIFCIIVVAIDILLLLLVLEETSDTSFTPECPEIPQSERIDCTPDQQV
TEDICRWQYKCCWSPVADANVPRCFFPWNWGYEASDGHTNTSTGFTTQLKRLPSPSLFGN
DVATTLFTAEYQTSNRFHFKITDFNNIRYEVSHENINLVDGTADASNLSYYVEVTDKPFS
IKIMRTSNRRVLLDTSIGPLQFAQQYLQLSFRLPSANVYGLGEHVHQQYRHNMTWKTWPI
FTRDATPTEGMINLYGAHTFFLCLEDASGSSFGVFLMNSNAMEVTLQPAPAITYRMIGGI
LDFYVFLGNTPEQVVQEYLELVGRPFLPPYWSLGFQLSRRDYGGINKLKEVVSRNRLAEI
PYDVQYSDIDYMDGKKDFTVDEVAYSGLPDFVKELHDNGQKYLIIMNPGISKNSNYEPYN
NGSLKRVWILGNNGFAVGEGYPGPTVFPDYTNPVCTEWWIDQVAKFHDRLEFDGVWIVSC
YC
Download sequence
Identical sequences ENSNLEP00000003146 ENSNLEP00000003146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]