SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003164 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003164
Domain Number 1 Region: 241-341
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.88e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000613
Further Details:      
 
Domain Number 2 Region: 93-156
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000262
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.053
Further Details:      
 
Domain Number 3 Region: 14-70
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000602
Family HLH, helix-loop-helix DNA-binding domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003164   Gene: ENSNLEG00000002481   Transcript: ENSNLET00000003324
Sequence length 669
Comment pep:known_by_projection supercontig:Nleu1.0:GL397417.1:1751323:1796025:1 gene:ENSNLEG00000002481 transcript:ENSNLET00000003324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGLQRARSTTELRKEKSRDAARSRRSQETEVLYQLAHTLPFARGVSAHLDKASIMRLT
ISYLRMHRLCAAGEWNQVGAGGEPLDACYLKALEGFVMVLTAEGDMAYLSENVSKHLGLS
QLELIGHSIFDFIHPCDQEELQDALTPQQTLSRRKVEAPTERCFSLRMKSTLTSRGRTLN
LKAATWKVLHCSGHMRAYKPPAQTSPAGSPDSEPPLQCLVLICEAIPHPGSLEPPLGRGA
FLSRHSLDMKFTYCDDRIAEVAGYSPDDLIGCSAYEYIHALDSDAVSKSIHTLLSKGQAV
TGQYRFLARSGGYLWTQTQATVVSGGRGPQSESIVCVHFLISRVEETGVVLSLEQTEQHS
RRPIQRGAPSQKDTPNPGDSLDAPGPRILAFLHPPSLSEAALAADPRRFCSPDLRRLLGP
ILDGASVAATPSTPLTTRCPQSPLSADLPHELPVGTENVHRLFTSGKDTEAVETDLDIAQ
DADALDLEMLAPYISMDDDFQLNASEQLPRAYHRPLGAVPRPRARSFHGLSPPALEPSLL
PRWGSDPRLSCSSPSRGDPSASSPMAGARKRTLAQSSEDEDEGVELLGVRPPKRSPSPEP
ENFLLFPLSLSFLLTGGPAPGSLQDPSTPLLNLNEPLGLGPSLLSPYSDEDTTQPGGTFQ
PRAGSAQAN
Download sequence
Identical sequences G1QQE6
XP_003277652.1.23891 ENSNLEP00000003164 ENSNLEP00000003164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]