SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003381 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003381
Domain Number 1 Region: 48-204
Classification Level Classification E-value
Superfamily L domain-like 1.7e-30
Family U2A'-like 0.084
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000003381
Domain Number - Region: 852-956
Classification Level Classification E-value
Superfamily Urocanase 0.0497
Family Urocanase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003381   Gene: ENSNLEG00000002703   Transcript: ENSNLET00000003548
Sequence length 1031
Comment pep:known_by_projection supercontig:Nleu1.0:GL397324.1:13343317:13382484:1 gene:ENSNLEG00000002703 transcript:ENSNLET00000003548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAMEAAAAAAAEVENGDGDSSCGDVCFMDKGLQSISELSLDSTLHAVNLHCNNIFKIEAI
DHIWNLRHLDLSSNQISQIEGLNTLTKLCTLNLSCNLITKVEGLEELINLTRLNVSYNHI
DDLSGLIPLHGIKHKLRYIDLHSNCIDSIHHLLQCMVGLHFLTNLILEKDGDDNPVCRLP
GYRAVILQTLPQLRILDCKNIFGEPVNLAEINSSQLQCLEGLLDNLVSSDSPLNISEDEI
IDRMPVITAPIDELVPLEQFASTPSDAVLTSFMSVRQSSEPEKSNHESDLQNEIKLQKLD
DQILQLLNETSNSIYNVPEKDPRPKRDTDITSESDYGNRKECNRKVPRRSKIPYYAKTIQ
TVKHHNKNYNSFVSCNRKMKPPYLKELYVSSSLANCSMLQESEKPKTEIIKVDQSHSEDN
TYQSLVEQLDQEREKRWRAEQAENKLMDYIDELHKHANEKEDIHSLALVTTDRLKEIIFR
ERNSKRQLEVMVHKLQSEIKKLTVELMKAKDQQEDHLKHLRTLEKALEKMERQKRQQQAA
QVRLIQEVELKASAADREIHLLRTSLHREREQVQQLHELLALKEQEHRKELETREVFTDA
EFQDAVAKEIAKEEKKHEQVIKEYQEKIDVLSQQYMDLENEFRIALTVEAKRFQDVKDGF
ENVATELAKSKHALIWAQRKENESSSLIKDLTCMVKEQKTKLEEVSKLKQETAANLQNQI
NTLEILIEDDKQKSIQIELLKHEKVQLISELAAKESLIFGLRTERKVWGHELAQQGSSLA
QNRGKLEAQIESLSRENECLRKTNESDSDALRIKCKIIDDQTETIRKLKDCLQEKDEHIK
RLQEKITEIEKCTQEQLDEKSSQLDEVLEKLERHNERKEKLKQQLKGKEVELEEIRKAYS
TLNQKWHDKGELLCHLETQVKEVKEKFENKEKKLKAERDKSIELQKNAIEKLHSMDNAFK
KQVDAIVEAHQAEIAQLANEKQKCIDSANLKVHQIEKEMRELLEETCKNKKTMEAKIKQL
AFALNEIQQDM
Download sequence
Identical sequences ENSNLEP00000003381 ENSNLEP00000003381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]