SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003494 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003494
Domain Number 1 Region: 11-148
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.000000000000105
Family Integrin alpha N-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 36-96,168-314
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000659
Family Quinoprotein alcohol dehydrogenase-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003494   Gene: ENSNLEG00000002875   Transcript: ENSNLET00000003667
Sequence length 332
Comment pep:known_by_projection supercontig:Nleu1.0:GL397358.1:2823989:2836940:1 gene:ENSNLEG00000002875 transcript:ENSNLET00000003667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSVSYVQRVALEFSGSLFPHAICLGDVDNDTLNELVVGDTSGKVSVYKNDDSRPWLTCS
CQGMLTCVGVGDVCNKGKNLLVAVSAEGWFHLFDLTPAKMLDASGHHETLIGEEQRPVFK
QHIPANTKVMLISDIDGDGCRELVVGYTDRVVRAFRWEELGEGPEHLTGQLVSLKKWMLE
GQVDSLSVTLGPLGLPELMVSQPGCAYAILLCTWKKDTGNFTSTIHNKNVSTHLIGNIKQ
GHGTESSGSGLFALCTLDGTLKLMEEMEEADKLLWSVQVDHQLFALEKLDVTGNGHEEVV
ACAWDGQTYIIDHNRTVVRFQVDENIRAFCAG
Download sequence
Identical sequences ENSNLEP00000003494 ENSNLEP00000003494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]