SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003569 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000003569
Domain Number - Region: 218-250
Classification Level Classification E-value
Superfamily Kringle-like 0.0628
Family Kringle modules 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003569   Gene: ENSNLEG00000002911   Transcript: ENSNLET00000003743
Sequence length 406
Comment pep:known_by_projection supercontig:Nleu1.0:GL397304.1:10182120:10239470:-1 gene:ENSNLEG00000002911 transcript:ENSNLET00000003743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQAGFPLGILLLFWVSYVTDFSLVLLIKGGALSGTDTYQSLVNKTFGFPGYLLLSVLQF
LYPFIAMISYNIIAGDTLSKVFQRIPGVDPENVFIGRHFIIGLSTVTFTLPLSLYRNIAK
LGKVSLISTGLTTLILGIVMARAISLSPHIPKTEDAWVFAKPNAIQAVGVMSFAFICHHN
SFLVYSSLEEPTVAKWSRLIHMSIVISVFICIFFATCGYLTFTGFTQGDLFENYCRNDDL
VTFGRFCYGVTVILTYPMECFVTREVIANVFFGGNLSSVFHIVVTVMVITVATLVSLMID
CLGIVLELNGVLCATPLIFIIPSACYLKLSEEPRTHSDKIMSCVMLPIGAVVMVFGFVMA
ITNPQDCTHGQEMFYCFPDNFSLTNTSESHVQQTTQLSILNISIFQ
Download sequence
Identical sequences A0A2I3HYD6
ENSNLEP00000003569 ENSNLEP00000003569 XP_003266229.1.23891 XP_003266231.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]