SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003580 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003580
Domain Number 1 Region: 305-391
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000628
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00094
Further Details:      
 
Domain Number 2 Region: 146-198
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000144
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.034
Further Details:      
 
Domain Number 3 Region: 45-97
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000628
Family HLH, helix-loop-helix DNA-binding domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003580   Gene: ENSNLEG00000002946   Transcript: ENSNLET00000003755
Sequence length 583
Comment pep:known_by_projection supercontig:Nleu1.0:GL397417.1:2531630:2555836:1 gene:ENSNLEG00000002946 transcript:ENSNLET00000003755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPYPGSGGGSEVKCVGGRGASVPWDFLPGLMVKAPSGPCLQAQRKEKSRNAARSRRGK
ENLEFFELAKLLPLPGAISSQLDKASIVRLSVTYLRLRRFAALGAPPWGLRAAGPPAGLA
PGRRGPAALVSEVFEQHLGGHILQSLDGFVFALNQEGKFLYISETVSIYLGLSQVEMTGS
SVFDYIHPGDHSEVLEQLGLRTPTPGPPTPPSVSSSSSSSSSLADTPEIEASLTKVSPSS
LVQERSFFVRMKSTLTKRGLHVKASGYKVIHVTGRLRAHALGLVALGHTLPPAPLAELPL
HGHMIVFRLSLGLTILACESRVSDHMDLGPSELVGRSCYQFVHGQDATRIRQSHVDLLDK
GQVMTGYYRWLQRAGGFVWLQSVATVAGSGKSPGEHHVLWVSHVLSQAEGGQTPLDAFQL
PASMACEEASSPGPEPTEPEPPTEGKQAAPAKNEAPLTQGKRIKVEPGPRETKGSEDSGD
EDPSGHPATPRPEFTSVIRAGVLKQDPVRPWGLAPPGDPPPALLHAGFLPPVVRGLCTPG
AIRYGPAELGLVYPHLQRLGPGPALPEAFYPPLGLPYPGPAGT
Download sequence
Identical sequences XP_012352120.1.23891 ENSNLEP00000003580 ENSNLEP00000003580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]