SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003675 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003675
Domain Number 1 Region: 12-138
Classification Level Classification E-value
Superfamily DNA clamp 9.71e-17
Family DNA polymerase processivity factor 0.025
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000003675
Domain Number - Region: 171-240
Classification Level Classification E-value
Superfamily DNA clamp 0.0974
Family DNA polymerase processivity factor 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003675   Gene: ENSNLEG00000002983   Transcript: ENSNLET00000003858
Sequence length 429
Comment pep:known_by_projection supercontig:Nleu1.0:GL397469.1:1595425:1626378:1 gene:ENSNLEG00000002983 transcript:ENSNLET00000003858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMLKCVMSGSQVKVFGKAVQALSRISDELWLDPSKKGLALRCVNSSRSAYGCVLFSPV
FFQHYQWSALVKMNENELDPTLNLKCKLGMKSILPIFRCLNSLERNIEKCQIFTRSDKCK
VVIQFFYRHGIKRTHNICFQESQPLQVIFDKNVCTNTLMIQPRLLADAIVLFTSSQEEVT
LAVTPLNFCLKSSNEESMDLSNAVYSEMFVGSDEFDFFQIGMDTEITFCFKELKGILTFS
EATHAPISIYFDFPGKPLALSIDDMLVEANFILATLAEEPSRASSPQSLCLSQKRKRSDL
IEKKAGKNVTGQALECISRKAAPRKLYPKKTLTNISALENCGSPAMKRADGDVSEVSESS
VSNTEEVPGSLCLRKFSCIFFGAVSSDQQEHFNHPFDSLAKASDSEEDMNNVCCIKEFNG
SGTKYFCII
Download sequence
Identical sequences G1QRV7
XP_003279730.1.23891 ENSNLEP00000003675 ENSNLEP00000003675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]