SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000003807 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000003807
Domain Number 1 Region: 591-670,887-1094
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.43e-63
Family Protein kinases, catalytic subunit 0.00057
Further Details:      
 
Domain Number 2 Region: 109-271,309-358
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.44e-17
Family Quinoprotein alcohol dehydrogenase-like 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000003807
Domain Number - Region: 466-529
Classification Level Classification E-value
Superfamily TM1622-like 0.0994
Family TM1622-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000003807   Gene: ENSNLEG00000003042   Transcript: ENSNLET00000003999
Sequence length 1120
Comment pep:known_by_projection supercontig:Nleu1.0:GL397319.1:14697605:14769980:-1 gene:ENSNLEG00000003042 transcript:ENSNLET00000003999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERAISPGLLVRALLLLLLLLLLLLRLSTRTVAAGRARGLPAPTAEAAFGLGAAAAPTSA
TRVPAAGAVAAAEVTVEDAEALPAAAGEQEPRGPEPDDEAELRPRGRSLVIISTLDGRIA
ALDPENHGKKQWDLDVGSGSLVSSSLSKPEVFGNKMIIPSLDGDLFQWDRDRESMETVPF
TVESLLESSYKFGDDVVLVGGKSLTTYGLSAYSGKVRYICSALGCRQWDSDEMEQEEDIL
LLQRTQKTVRAVGPRSGNEKWNFSVGHFELRYIPDMETRAGFIESTFKPNENTEESKIIS
DVEEQEAAIMDIVIKVSVADWKVMAFSKKGGHLEWEYQFCTPIASAWLLKDGKVIPISLF
DDTSYTSNDDVLEDEEDIVEAARGATENSVYLGMYRGQLYLQSSVRISEKFPSSPKALES
VNNENAIIPLPTIKWKPLIHSPSRTPVLVGSDEFDKCLSNDKFSHEEYSNGALSILQYPY
DNGYYLPYYKRERNKRSTQITVRFLDNPNYNKNIRKKDPVLLLHWWKEIVATILFCIIAT
TFIVRRLFHPHPHRQRKESETQCQTENKYDSVSGEANDSSWNDIKNSGYISRYLTDFEPI
QCLGRGGFGVVFEAKNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIVRYFN
AWLEAPPEKWQEKMDEIWLKDESTDWPLSSPSPMDAPSVKIRRMDPFFTKEHIEIIAPSP
QRSRSFSVGISCDQTSSSESQFSPLEFSGMDHEDISESVDAAYNLQDSCLTDCDVEDGTM
DGNDEGHSFELCPSEASPYVRSRERTSSSIVFEDSGCDNASSKEEPKTNQLHIGNHCANK
LTAFKPTSSKSSSEATLSVSPPRPTTLSLDLTKNTTEKLQPSSPKVYLYIQMQLCRKENL
KDWMNGRCTIEERERSMCLHIFLQIAEAVEFLHSKGLMHRDLKPSNIFFTMDDVVKVGDF
GLVTAMDQDEEEQTVLTPMPAYARHTGQVGTKLYMSPEQIHGNSYSHKVDIFSLGLILFE
LLYPFSTQMERVRTLTDVRNLKFPPLFTQKYPCEYVMVQDMLSPSPMERPEATNIIENAV
FEDLDFPGKTVLRQRSRSLSSSGTKHSRQSNNSHSPLPSN
Download sequence
Identical sequences G1QS89
ENSNLEP00000003807 XP_003268838.1.23891 ENSNLEP00000003807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]