SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004076 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004076
Domain Number 1 Region: 381-443
Classification Level Classification E-value
Superfamily BPTI-like 1.7e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0053
Further Details:      
 
Domain Number 2 Region: 240-303
Classification Level Classification E-value
Superfamily BPTI-like 2.55e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0045
Further Details:      
 
Domain Number 3 Region: 334-372
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000785
Family LDL receptor-like module 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000004076
Domain Number - Region: 213-242
Classification Level Classification E-value
Superfamily PKD domain 0.0106
Family PKD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004076   Gene: ENSNLEG00000003298   Transcript: ENSNLET00000004276
Sequence length 531
Comment pep:known_by_projection supercontig:Nleu1.0:GL397306.1:1764641:1778366:1 gene:ENSNLEG00000003298 transcript:ENSNLET00000004276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPARTMAGACLAPARIPAVALWLLCALGLQGTQAGPPPAPPGLPAGADCLNRFTAGVPA
FVLDTNASVSNGATFLESPTVRRGWDCVRACCTTQNCNLALVELQPDRGEDAIAACFLIN
CLYEQNFVCKFAPREGFINYLTREVYRSYRQLRTQGFGGSGIPKAWAGIDLKVQPQEPLV
LKDVENTDWRLLRGDTDVRVERKDPNQVELWGLKEGTYLFQLTVTSSDHPEDTANVTVTV
LSTKQTEDYCLASNKVGRCRGSFPRWYYDPTEQICKSFVYGGCLGNKNNYLREEECILAC
RGVQGGPLRGSSGAQATFPQGPSMERRHPVCSGTCQPTQFRCSNGCCIDSFLECDDTPNC
PDASDESACEKYTSGFDELQRIHFPSDKGHCVDLPDTGLCKESIPRWYYNPFSEHCARFT
YGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRRESPISSTGSVEMAIAVFLVICIVVVV
AILSYCFFKDQRKGFSRHRHRHHPPPTPASSTVSTTEDTEHLVYNHTTRPL
Download sequence
Identical sequences ENSNLEP00000004076 ENSNLEP00000004076 XP_003266791.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]