SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004135 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004135
Domain Number 1 Region: 16-387
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.35e-68
Family L-arabinose binding protein-like 0.0012
Further Details:      
 
Domain Number 2 Region: 407-521,640-780
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.39e-66
Family Phosphate binding protein-like 0.00000000106
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000004135
Domain Number - Region: 490-635
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000392
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004135   Gene: ENSNLEG00000003377   Transcript: ENSNLET00000004343
Sequence length 879
Comment pep:known_by_projection supercontig:Nleu1.0:GL397293.1:15132168:15290315:-1 gene:ENSNLEG00000003377 transcript:ENSNLET00000004343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGIFETVENEPVNVEELAFKFAVTSINRNRTLMPNTTLTYDIQRINLFDSFEASRRACDQ
LALGVAALFGPSHSSSISAVQSICNALEVPHIQTRWKHPSVDNKDLFYINLYPDYAAISR
AILDLVLYYNWKTVTVVYEDSTGLIRLQELIKAPSRYNIKIKIRQLPSGNKDAKPLLKEM
KKGKEFYVIFDCSHETAAEILKQILFMGMMTEYYHYFFTTLDLFALDLELYRYSGVNMTG
FRLLNIDNPHVSSIIEKWSMERLQAPPRPETGLLDGMMTTEAALMYDAVYMVAIASHRAS
QLTVSSLQCHRHKPWRLGPRFMNLIKEARWDGLTGHITFNKTNGLRKDFDLDIISLKEEG
TEKAAGEVSKHLYKVWKKIGIWNSNSGLNMTDSNKDKSSNITDSLANRTLVVTTILEEPY
VMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFIYDVKLVPDGKYGAQNDKGEWNGMVKE
LIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIW
MYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGS
ELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGA
VRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVLTTDYALLMESTSIEY
VTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGC
PEEDNKEASALGVENIGGIFIVLAAGLVLSVFVAIGEFVYKSRKNNDIEQAFCFFYGLQC
KQTHPTNSTSGTTLSTDLECGKLIREERGIRKQSSVHTV
Download sequence
Identical sequences ENSNLEP00000004135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]