SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004213 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004213
Domain Number 1 Region: 70-680
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 1.44e-229
Family Aconitase iron-sulfur domain 1.01e-16
Further Details:      
 
Domain Number 2 Region: 685-938
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 2.94e-82
Family LeuD-like 0.000000000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004213   Gene: ENSNLEG00000003409   Transcript: ENSNLET00000004434
Sequence length 940
Comment pep:known_by_projection supercontig:Nleu1.0:GL397291.1:19027262:19100861:1 gene:ENSNLEG00000003409 transcript:ENSNLET00000004434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAAAPGARGGGAWRGQLERRSARERVPPLGSGSPVAGAPPCSRRNRWPSVIMSNPFAHLA
EPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNCDEFLVKKQDIENILHWNVM
QHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPVCPADLVIDHSIQ
VDFNRRADSLQKNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGIIHQVNLEYLARVV
FDQDGYYYPDSLVGTDSHTTMIDGLGILGWGVGGIEAEAVMLGQPISMVLPQVIGYRLMG
KPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMCPEYGATAGF
FPVDEVSIMYLAQTGRDEEKLKYIKKYLQAVGMFRDFNDPSQDPDFTQVVELDLKTVVPC
CSGPKRPQDKVAVSNMKKDFESCLGAKQGFKGFQVAPEHHNDCKTFIYDNTEFTLAHGSV
VIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLNVMPYIKTSLSPGSGVVTYYLQESGVMP
YLSQLGFDVVGYGCMTCIGNSGPLPEPVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRAN
YLASPPLVIAYAIAGTIRIDFEKEPLGVNAKGQQVFLKDIWPTRDEIQAVERQYVIPGMF
KEVYQKIETVNESWNALATPSDKLFFWNSKSTYIKSPPFFENLTLDLQLPKSIVDAYVLL
NLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAVMARGTFANIRL
LNRFLNKQAPQTIHLPSGEILDVFDAAERYQQAGLPLIVLAGKEYGAGSSRDWAAKGPFL
LGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPRMKV
QIKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK
Download sequence
Identical sequences ENSNLEP00000004213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]