SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004506 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004506
Domain Number 1 Region: 125-322,425-500
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000314
Family Quinoprotein alcohol dehydrogenase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004506   Gene: ENSNLEG00000003731   Transcript: ENSNLET00000004743
Sequence length 622
Comment pep:known_by_projection supercontig:Nleu1.0:GL397301.1:4329084:4368439:1 gene:ENSNLEG00000003731 transcript:ENSNLET00000004743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVLSRALKLPGKKSPDLGEYDPLTQADSDESEDDLVLNLQKNGGVKNGKSPLGEAPEP
DSDAEVAEAAKPHLSEVTTEDYPSEPLGGLEQKGASSLVSYVRTSVFLLTLGISMILVLL
CAFLIPCPPRDLHSTWSRHLGSQGGGDLSPLELADVNGDGLRDVLLSFVMSRNRSAVGVS
RPAANLVCLSGMNGSTLWSSLLPEEVRDITCLELMPGSLAETTCLVTGTHKMLSAFNATS
GKAIWTLNPNYLSNGTLAAPVVVLPDLDEDGVRDLVVLAIGELQPDLCFLLVSGRTGNPV
GRPVKYNIVGVGNLIGPQVYITTNGAVYILFGFGNIQAVALRDIFVQAQNRDSSPPSLQI
EEPEWEKRRSINLSELIDVYSDGVELLQMVKAPDSNCSNLLITTRQSLVLLRGQNLTPYW
ALRLQGLRSQPTPGYFTDDQTLDFLLQIQDGVGMKKMMVVDGNSGSVVWSYRAPCHMKET
PATSAVTSDQKSVFLFWAEGLSAASPNSDIILGTEPPSLHHLYLLHPAFPSILLDLANTT
GTVTASEVGINDLWKDAFYVTRTTGPSSEGHPAALVVSKLSLRWALMEGQMAQLQESTPK
IGRGELRRFLSRIKFVEAPYEI
Download sequence
Identical sequences ENSNLEP00000004506 ENSNLEP00000004506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]